Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1773913..1774138 | Replicon | chromosome |
| Accession | NZ_LR213452 | ||
| Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | E0E33_RS08900 | Protein ID | WP_000813254.1 |
| Coordinates | 1773983..1774138 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1773913..1773971 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E33_RS08855 | 1769100..1770362 | - | 1263 | Protein_1698 | tyrosine-type recombinase/integrase | - |
| E0E33_RS08865 | 1770700..1771497 | - | 798 | WP_024260703.1 | DgsA anti-repressor MtfA | - |
| E0E33_RS08875 | 1771708..1772748 | - | 1041 | WP_005096324.1 | tyrosine-type recombinase/integrase | - |
| E0E33_RS08880 | 1772748..1772888 | - | 141 | Protein_1701 | DUF4224 domain-containing protein | - |
| E0E33_RS08885 | 1772915..1773331 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 1773913..1773971 | - | 59 | - | - | Antitoxin |
| E0E33_RS08900 | 1773983..1774138 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| E0E33_RS08910 | 1774306..1774584 | + | 279 | WP_011069426.1 | hypothetical protein | - |
| E0E33_RS08915 | 1774586..1775644 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| E0E33_RS08920 | 1775645..1776010 | + | 366 | WP_128832266.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E0E33_RS08925 | 1776007..1776690 | + | 684 | WP_005049343.1 | antiterminator | - |
| E0E33_RS08955 | 1777491..1777706 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| E0E33_RS08960 | 1777805..1778479 | + | 675 | WP_004967157.1 | IS66 family insertion sequence hypothetical protein | - |
| E0E33_RS08965 | 1778476..1778826 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 1765792..1807437 | 41645 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T288244 WP_000813254.1 NZ_LR213452:1773983-1774138 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT288244 NZ_LR213452:c1773971-1773913 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|