Detailed information of TA system TA288244

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 1773913..1774138
• Replicon: chromosome
• Accession: NZ_LR213452
• Organism: Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: S1ELB5
• Locus tag: E0E33_RS08900
• Protein ID: WP_000813254.1
• Coordinates: 1773983..1774138 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	1773913..1773971 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E0E33_RS08855	1769100..1770362	-	1263	Protein_1698	tyrosine-type recombinase/integrase	-
E0E33_RS08855	1769100..1770362	-	1263	Protein_1698	tyrosine-type recombinase/integrase	-
E0E33_RS08865	1770700..1771497	-	798	WP_024260703.1	DgsA anti-repressor MtfA	-
E0E33_RS08865	1770700..1771497	-	798	WP_024260703.1	DgsA anti-repressor MtfA	-
E0E33_RS08875	1771708..1772748	-	1041	WP_005096324.1	tyrosine-type recombinase/integrase	-
E0E33_RS08875	1771708..1772748	-	1041	WP_005096324.1	tyrosine-type recombinase/integrase	-
E0E33_RS08880	1772748..1772888	-	141	Protein_1701	DUF4224 domain-containing protein	-
E0E33_RS08880	1772748..1772888	-	141	Protein_1701	DUF4224 domain-containing protein	-
E0E33_RS08885	1772915..1773331	+	417	WP_005069274.1	hypothetical protein	-
E0E33_RS08885	1772915..1773331	+	417	WP_005069274.1	hypothetical protein	-
-	1773913..1773971	-	59	-	-	Antitoxin
E0E33_RS08900	1773983..1774138	+	156	WP_000813254.1	type I toxin-antitoxin system toxin HokD	Toxin
E0E33_RS08900	1773983..1774138	+	156	WP_000813254.1	type I toxin-antitoxin system toxin HokD	Toxin
E0E33_RS08910	1774306..1774584	+	279	WP_011069426.1	hypothetical protein	-
E0E33_RS08910	1774306..1774584	+	279	WP_011069426.1	hypothetical protein	-
E0E33_RS08915	1774586..1775644	+	1059	WP_001265248.1	DUF968 domain-containing protein	-
E0E33_RS08915	1774586..1775644	+	1059	WP_001265248.1	DUF968 domain-containing protein	-
E0E33_RS08920	1775645..1776010	+	366	WP_128832266.1	RusA family crossover junction endodeoxyribonuclease	-
E0E33_RS08920	1775645..1776010	+	366	WP_128832266.1	RusA family crossover junction endodeoxyribonuclease	-
E0E33_RS08925	1776007..1776690	+	684	WP_005049343.1	antiterminator	-
E0E33_RS08925	1776007..1776690	+	684	WP_005049343.1	antiterminator	-
E0E33_RS08955	1777491..1777706	+	216	WP_000839572.1	class II holin family protein	-
E0E33_RS08955	1777491..1777706	+	216	WP_000839572.1	class II holin family protein	-
E0E33_RS08960	1777805..1778479	+	675	WP_004967157.1	IS66 family insertion sequence hypothetical protein	-
E0E33_RS08960	1777805..1778479	+	675	WP_004967157.1	IS66 family insertion sequence hypothetical protein	-
E0E33_RS08965	1778476..1778826	+	351	WP_005049241.1	IS66 family insertion sequence element accessory protein TnpB	-
E0E33_RS08965	1778476..1778826	+	351	WP_005049241.1	IS66 family insertion sequence element accessory protein TnpB	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	ipaH9.8	1765792..1807437	41645

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5736.89 Da
• Isoelectric Point: 6.1531

>T288244 WP_000813254.1 NZ_LR213452:1773983-1774138 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT288244 NZ_LR213452:c1773971-1773913 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Structures

Toxin

• AlphaFold DB: A0A4P7TMW0

Antitoxin