Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 651623..652350 | Replicon | chromosome |
| Accession | NZ_LR213452 | ||
| Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | E0E33_RS03310 | Protein ID | WP_000550189.1 |
| Coordinates | 651623..651937 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | E0E33_RS03315 | Protein ID | WP_000560266.1 |
| Coordinates | 651934..652350 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E33_RS03290 | 647772..648770 | - | 999 | WP_005050984.1 | Gfo/Idh/MocA family oxidoreductase | - |
| E0E33_RS03295 | 648849..649541 | - | 693 | WP_000942537.1 | vancomycin high temperature exclusion protein | - |
| E0E33_RS03300 | 649614..650117 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| E0E33_RS03305 | 650202..651338 | + | 1137 | WP_000018658.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| E0E33_RS03310 | 651623..651937 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| E0E33_RS03315 | 651934..652350 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| E0E33_RS03320 | 652395..654413 | - | 2019 | WP_000121486.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| E0E33_RS03325 | 654639..656998 | - | 2360 | Protein_637 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T288242 WP_000550189.1 NZ_LR213452:651623-651937 [Shigella flexneri]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT288242 WP_000560266.1 NZ_LR213452:651934-652350 [Shigella flexneri]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|