Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 206806..207028 | Replicon | chromosome |
| Accession | NZ_LR213452 | ||
| Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | E0E33_RS00990 | Protein ID | WP_001295224.1 |
| Coordinates | 206921..207028 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 206806..206872 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E33_RS00970 | 202247..203149 | + | 903 | WP_000084666.1 | dipeptide ABC transporter permease DppC | - |
| E0E33_RS00975 | 203160..204143 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| E0E33_RS00980 | 204140..205144 | + | 1005 | WP_000107041.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| E0E33_RS00985 | 205174..206445 | - | 1272 | WP_005052340.1 | amino acid permease | - |
| - | 206806..206872 | - | 67 | - | - | Antitoxin |
| E0E33_RS00990 | 206921..207028 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 207290..207346 | - | 57 | NuclAT_23 | - | - |
| - | 207290..207346 | - | 57 | NuclAT_23 | - | - |
| - | 207290..207346 | - | 57 | NuclAT_23 | - | - |
| - | 207290..207346 | - | 57 | NuclAT_23 | - | - |
| - | 207290..207346 | - | 57 | NuclAT_26 | - | - |
| - | 207290..207346 | - | 57 | NuclAT_26 | - | - |
| - | 207290..207346 | - | 57 | NuclAT_26 | - | - |
| - | 207290..207346 | - | 57 | NuclAT_26 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_29 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_29 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_29 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_29 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_32 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_32 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_32 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_32 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_35 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_35 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_35 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_35 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_38 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_38 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_38 | - | - |
| - | 207292..207346 | - | 55 | NuclAT_38 | - | - |
| E0E33_RS01000 | 207404..207511 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | - |
| - | 207773..207830 | - | 58 | NuclAT_24 | - | - |
| - | 207773..207830 | - | 58 | NuclAT_24 | - | - |
| - | 207773..207830 | - | 58 | NuclAT_24 | - | - |
| - | 207773..207830 | - | 58 | NuclAT_24 | - | - |
| - | 207773..207830 | - | 58 | NuclAT_27 | - | - |
| - | 207773..207830 | - | 58 | NuclAT_27 | - | - |
| - | 207773..207830 | - | 58 | NuclAT_27 | - | - |
| - | 207773..207830 | - | 58 | NuclAT_27 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_30 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_30 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_30 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_30 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_33 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_33 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_33 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_33 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_36 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_36 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_36 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_36 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_39 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_39 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_39 | - | - |
| - | 207775..207830 | - | 56 | NuclAT_39 | - | - |
| E0E33_RS01010 | 207887..207994 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 208256..208313 | - | 58 | NuclAT_22 | - | - |
| - | 208256..208313 | - | 58 | NuclAT_22 | - | - |
| - | 208256..208313 | - | 58 | NuclAT_22 | - | - |
| - | 208256..208313 | - | 58 | NuclAT_22 | - | - |
| - | 208256..208313 | - | 58 | NuclAT_25 | - | - |
| - | 208256..208313 | - | 58 | NuclAT_25 | - | - |
| - | 208256..208313 | - | 58 | NuclAT_25 | - | - |
| - | 208256..208313 | - | 58 | NuclAT_25 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_28 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_28 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_28 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_28 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_31 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_31 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_31 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_31 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_34 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_34 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_34 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_34 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_37 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_37 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_37 | - | - |
| - | 208258..208313 | - | 56 | NuclAT_37 | - | - |
| E0E33_RS01020 | 208370..208477 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| E0E33_RS01025 | 208564..210243 | - | 1680 | WP_000191557.1 | cellulose biosynthesis protein BcsG | - |
| E0E33_RS01030 | 210240..210431 | - | 192 | WP_000988299.1 | cellulose biosynthesis protein BcsF | - |
| E0E33_RS01035 | 210428..211999 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T288240 WP_001295224.1 NZ_LR213452:206921-207028 [Shigella flexneri]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT288240 NZ_LR213452:c206872-206806 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|