Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 206806..207028 Replicon chromosome
Accession NZ_LR213452
Organism Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag E0E33_RS00990 Protein ID WP_001295224.1
Coordinates 206921..207028 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 206806..206872 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E33_RS00970 202247..203149 + 903 WP_000084666.1 dipeptide ABC transporter permease DppC -
E0E33_RS00970 202247..203149 + 903 WP_000084666.1 dipeptide ABC transporter permease DppC -
E0E33_RS00975 203160..204143 + 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
E0E33_RS00975 203160..204143 + 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
E0E33_RS00980 204140..205144 + 1005 WP_000107041.1 dipeptide ABC transporter ATP-binding subunit DppF -
E0E33_RS00980 204140..205144 + 1005 WP_000107041.1 dipeptide ABC transporter ATP-binding subunit DppF -
E0E33_RS00985 205174..206445 - 1272 WP_005052340.1 amino acid permease -
E0E33_RS00985 205174..206445 - 1272 WP_005052340.1 amino acid permease -
- 206806..206872 - 67 - - Antitoxin
E0E33_RS00990 206921..207028 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
E0E33_RS00990 206921..207028 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 207290..207346 - 57 NuclAT_23 - -
- 207290..207346 - 57 NuclAT_23 - -
- 207290..207346 - 57 NuclAT_23 - -
- 207290..207346 - 57 NuclAT_23 - -
- 207290..207346 - 57 NuclAT_23 - -
- 207290..207346 - 57 NuclAT_23 - -
- 207290..207346 - 57 NuclAT_23 - -
- 207290..207346 - 57 NuclAT_23 - -
- 207290..207346 - 57 NuclAT_26 - -
- 207290..207346 - 57 NuclAT_26 - -
- 207290..207346 - 57 NuclAT_26 - -
- 207290..207346 - 57 NuclAT_26 - -
- 207290..207346 - 57 NuclAT_26 - -
- 207290..207346 - 57 NuclAT_26 - -
- 207290..207346 - 57 NuclAT_26 - -
- 207290..207346 - 57 NuclAT_26 - -
- 207292..207346 - 55 NuclAT_29 - -
- 207292..207346 - 55 NuclAT_29 - -
- 207292..207346 - 55 NuclAT_29 - -
- 207292..207346 - 55 NuclAT_29 - -
- 207292..207346 - 55 NuclAT_29 - -
- 207292..207346 - 55 NuclAT_29 - -
- 207292..207346 - 55 NuclAT_29 - -
- 207292..207346 - 55 NuclAT_29 - -
- 207292..207346 - 55 NuclAT_32 - -
- 207292..207346 - 55 NuclAT_32 - -
- 207292..207346 - 55 NuclAT_32 - -
- 207292..207346 - 55 NuclAT_32 - -
- 207292..207346 - 55 NuclAT_32 - -
- 207292..207346 - 55 NuclAT_32 - -
- 207292..207346 - 55 NuclAT_32 - -
- 207292..207346 - 55 NuclAT_32 - -
- 207292..207346 - 55 NuclAT_35 - -
- 207292..207346 - 55 NuclAT_35 - -
- 207292..207346 - 55 NuclAT_35 - -
- 207292..207346 - 55 NuclAT_35 - -
- 207292..207346 - 55 NuclAT_35 - -
- 207292..207346 - 55 NuclAT_35 - -
- 207292..207346 - 55 NuclAT_35 - -
- 207292..207346 - 55 NuclAT_35 - -
- 207292..207346 - 55 NuclAT_38 - -
- 207292..207346 - 55 NuclAT_38 - -
- 207292..207346 - 55 NuclAT_38 - -
- 207292..207346 - 55 NuclAT_38 - -
- 207292..207346 - 55 NuclAT_38 - -
- 207292..207346 - 55 NuclAT_38 - -
- 207292..207346 - 55 NuclAT_38 - -
- 207292..207346 - 55 NuclAT_38 - -
E0E33_RS01000 207404..207511 + 108 WP_000141634.1 type I toxin-antitoxin system toxic polypeptide LdrD -
E0E33_RS01000 207404..207511 + 108 WP_000141634.1 type I toxin-antitoxin system toxic polypeptide LdrD -
- 207773..207830 - 58 NuclAT_24 - -
- 207773..207830 - 58 NuclAT_24 - -
- 207773..207830 - 58 NuclAT_24 - -
- 207773..207830 - 58 NuclAT_24 - -
- 207773..207830 - 58 NuclAT_24 - -
- 207773..207830 - 58 NuclAT_24 - -
- 207773..207830 - 58 NuclAT_24 - -
- 207773..207830 - 58 NuclAT_24 - -
- 207773..207830 - 58 NuclAT_27 - -
- 207773..207830 - 58 NuclAT_27 - -
- 207773..207830 - 58 NuclAT_27 - -
- 207773..207830 - 58 NuclAT_27 - -
- 207773..207830 - 58 NuclAT_27 - -
- 207773..207830 - 58 NuclAT_27 - -
- 207773..207830 - 58 NuclAT_27 - -
- 207773..207830 - 58 NuclAT_27 - -
- 207775..207830 - 56 NuclAT_30 - -
- 207775..207830 - 56 NuclAT_30 - -
- 207775..207830 - 56 NuclAT_30 - -
- 207775..207830 - 56 NuclAT_30 - -
- 207775..207830 - 56 NuclAT_30 - -
- 207775..207830 - 56 NuclAT_30 - -
- 207775..207830 - 56 NuclAT_30 - -
- 207775..207830 - 56 NuclAT_30 - -
- 207775..207830 - 56 NuclAT_33 - -
- 207775..207830 - 56 NuclAT_33 - -
- 207775..207830 - 56 NuclAT_33 - -
- 207775..207830 - 56 NuclAT_33 - -
- 207775..207830 - 56 NuclAT_33 - -
- 207775..207830 - 56 NuclAT_33 - -
- 207775..207830 - 56 NuclAT_33 - -
- 207775..207830 - 56 NuclAT_33 - -
- 207775..207830 - 56 NuclAT_36 - -
- 207775..207830 - 56 NuclAT_36 - -
- 207775..207830 - 56 NuclAT_36 - -
- 207775..207830 - 56 NuclAT_36 - -
- 207775..207830 - 56 NuclAT_36 - -
- 207775..207830 - 56 NuclAT_36 - -
- 207775..207830 - 56 NuclAT_36 - -
- 207775..207830 - 56 NuclAT_36 - -
- 207775..207830 - 56 NuclAT_39 - -
- 207775..207830 - 56 NuclAT_39 - -
- 207775..207830 - 56 NuclAT_39 - -
- 207775..207830 - 56 NuclAT_39 - -
- 207775..207830 - 56 NuclAT_39 - -
- 207775..207830 - 56 NuclAT_39 - -
- 207775..207830 - 56 NuclAT_39 - -
- 207775..207830 - 56 NuclAT_39 - -
E0E33_RS01010 207887..207994 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
E0E33_RS01010 207887..207994 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 208256..208313 - 58 NuclAT_22 - -
- 208256..208313 - 58 NuclAT_22 - -
- 208256..208313 - 58 NuclAT_22 - -
- 208256..208313 - 58 NuclAT_22 - -
- 208256..208313 - 58 NuclAT_22 - -
- 208256..208313 - 58 NuclAT_22 - -
- 208256..208313 - 58 NuclAT_22 - -
- 208256..208313 - 58 NuclAT_22 - -
- 208256..208313 - 58 NuclAT_25 - -
- 208256..208313 - 58 NuclAT_25 - -
- 208256..208313 - 58 NuclAT_25 - -
- 208256..208313 - 58 NuclAT_25 - -
- 208256..208313 - 58 NuclAT_25 - -
- 208256..208313 - 58 NuclAT_25 - -
- 208256..208313 - 58 NuclAT_25 - -
- 208256..208313 - 58 NuclAT_25 - -
- 208258..208313 - 56 NuclAT_28 - -
- 208258..208313 - 56 NuclAT_28 - -
- 208258..208313 - 56 NuclAT_28 - -
- 208258..208313 - 56 NuclAT_28 - -
- 208258..208313 - 56 NuclAT_28 - -
- 208258..208313 - 56 NuclAT_28 - -
- 208258..208313 - 56 NuclAT_28 - -
- 208258..208313 - 56 NuclAT_28 - -
- 208258..208313 - 56 NuclAT_31 - -
- 208258..208313 - 56 NuclAT_31 - -
- 208258..208313 - 56 NuclAT_31 - -
- 208258..208313 - 56 NuclAT_31 - -
- 208258..208313 - 56 NuclAT_31 - -
- 208258..208313 - 56 NuclAT_31 - -
- 208258..208313 - 56 NuclAT_31 - -
- 208258..208313 - 56 NuclAT_31 - -
- 208258..208313 - 56 NuclAT_34 - -
- 208258..208313 - 56 NuclAT_34 - -
- 208258..208313 - 56 NuclAT_34 - -
- 208258..208313 - 56 NuclAT_34 - -
- 208258..208313 - 56 NuclAT_34 - -
- 208258..208313 - 56 NuclAT_34 - -
- 208258..208313 - 56 NuclAT_34 - -
- 208258..208313 - 56 NuclAT_34 - -
- 208258..208313 - 56 NuclAT_37 - -
- 208258..208313 - 56 NuclAT_37 - -
- 208258..208313 - 56 NuclAT_37 - -
- 208258..208313 - 56 NuclAT_37 - -
- 208258..208313 - 56 NuclAT_37 - -
- 208258..208313 - 56 NuclAT_37 - -
- 208258..208313 - 56 NuclAT_37 - -
- 208258..208313 - 56 NuclAT_37 - -
E0E33_RS01020 208370..208477 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
E0E33_RS01020 208370..208477 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
E0E33_RS01025 208564..210243 - 1680 WP_000191557.1 cellulose biosynthesis protein BcsG -
E0E33_RS01025 208564..210243 - 1680 WP_000191557.1 cellulose biosynthesis protein BcsG -
E0E33_RS01030 210240..210431 - 192 WP_000988299.1 cellulose biosynthesis protein BcsF -
E0E33_RS01030 210240..210431 - 192 WP_000988299.1 cellulose biosynthesis protein BcsF -
E0E33_RS01035 210428..211999 - 1572 WP_001204920.1 cellulose biosynthesis protein BcsE -
E0E33_RS01035 210428..211999 - 1572 WP_001204920.1 cellulose biosynthesis protein BcsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T288240 WP_001295224.1 NZ_LR213452:206921-207028 [Shigella flexneri]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT288240 NZ_LR213452:c206872-206806 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References