Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 243272..243807 Replicon plasmid 2
Accession NZ_LR135476
Organism Enterococcus faecium isolate E8423

Toxin (Protein)


Gene name yoeB Uniprot ID R2PQC0
Locus tag EQB52_RS15230 Protein ID WP_002314366.1
Coordinates 243272..243544 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q3Y220
Locus tag EQB52_RS15235 Protein ID WP_002297422.1
Coordinates 243544..243807 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB52_RS15185 238378..238827 - 450 WP_010729386.1 TlpA family protein disulfide reductase -
EQB52_RS15725 238983..239525 - 543 WP_002298088.1 hypothetical protein -
EQB52_RS15200 239800..240443 + 644 Protein_268 transposase -
EQB52_RS15205 240519..241199 + 681 WP_002331383.1 IS6-like element IS1216 family transposase -
EQB52_RS15210 241258..241446 - 189 Protein_270 hypothetical protein -
EQB52_RS15215 241447..242304 - 858 WP_002292680.1 AAA family ATPase -
EQB52_RS15220 242589..242876 - 288 WP_002300557.1 type II toxin-antitoxin system RelE/ParE family toxin -
EQB52_RS15225 242866..243195 - 330 WP_002292678.1 AbrB family transcriptional regulator -
EQB52_RS15230 243272..243544 - 273 WP_002314366.1 Txe/YoeB family addiction module toxin Toxin
EQB52_RS15235 243544..243807 - 264 WP_002297422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB52_RS15240 244041..244949 + 909 WP_002295743.1 IS982-like element ISEfm1 family transposase -
EQB52_RS15245 244952..246127 - 1176 WP_002336205.1 MFS transporter -
EQB52_RS15250 246130..248379 - 2250 WP_106017163.1 alpha-galactosidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..256660 256660
- inside IScluster/Tn - - 231709..254408 22699


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10780.24 Da        Isoelectric Point: 9.9724

>T288223 WP_002314366.1 NZ_LR135476:c243544-243272 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9959.22 Da        Isoelectric Point: 4.5370

>AT288223 WP_002297422.1 NZ_LR135476:c243807-243544 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F704

Antitoxin

Source ID Structure
AlphaFold DB A0A829F006

References