Detailed information of TA system TA288216

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): Txe-Axe/Txe-RelB
• Location: 35809..36328
• Replicon: plasmid 4
• Accession: NZ_LR135446
• Organism: Enterococcus faecium isolate E7114

Toxin (Protein)

• Gene name: Txe
• Uniprot ID: Q848U6
• Locus tag: FSA55_RS15780
• Protein ID: WP_000588503.1
• Coordinates: 36071..36328 (+)
• Length: 86 a.a.

Antitoxin (Protein)

• Gene name: Axe
• Uniprot ID: Q83WJ8
• Locus tag: FSA55_RS15775
• Protein ID: WP_000388479.1
• Coordinates: 35809..36078 (+)
• Length: 90 a.a.

Genomic Context

Location: 34552..35118 (567 bp)
Type: Others
Protein ID: Protein_40

Location: 35283..35483 (201 bp)
Type: Others
Protein ID: WP_001033544.1

Location: 35499..35678 (180 bp)
Type: Others
Protein ID: WP_001120991.1

Location: 35809..36078 (270 bp)
Type: Antitoxin
Protein ID: WP_000388479.1

Location: 36071..36328 (258 bp)
Type: Toxin
Protein ID: WP_000588503.1

Location: 38298..39122 (825 bp)
Type: Others
Protein ID: WP_001809248.1

Location: 31594..32010 (417 bp)
Type: Others
Protein ID: WP_001232859.1

Location: 32013..32297 (285 bp)
Type: Others
Protein ID: WP_000353844.1

Location: 33796..34476 (681 bp)
Type: Others
Protein ID: WP_001015311.1

Location: 36703..37875 (1173 bp)
Type: Others
Protein ID: WP_000195429.1

Location: 39287..39901 (615 bp)
Type: Others
Protein ID: WP_001261742.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
FSA55_RS15745	31594..32010	-	417	WP_001232859.1	hypothetical protein	-
FSA55_RS15750	32013..32297	-	285	WP_000353844.1	hypothetical protein	-
FSA55_RS15755	33796..34476	-	681	WP_001015311.1	IS6-like element IS1216 family transposase	-
FSA55_RS15760	34552..35118	+	567	Protein_40	hypothetical protein	-
FSA55_RS15765	35283..35483	+	201	WP_001033544.1	4-hydroxybenzoate octaprenyltransferase	-
FSA55_RS15770	35499..35678	+	180	WP_001120991.1	hypothetical protein	-
FSA55_RS15775	35809..36078	+	270	WP_000388479.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
FSA55_RS15780	36071..36328	+	258	WP_000588503.1	Txe/YoeB family addiction module toxin	Toxin
FSA55_RS15785	36703..37875	-	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
FSA55_RS15790	38298..39122	+	825	WP_001809248.1	hypothetical protein	-
FSA55_RS15795	39287..39901	-	615	WP_001261742.1	recombinase family protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_014959 Enterococcus faecium Non-Mobilizable plasmid TA006115 1..39032 0.01	inside	Non-Mobilizable plasmid	erm(B) / ant(6)-Ia / aph(3')-III / VanHAX	-	1..44438	44438
	-	inside	IScluster/Tn	erm(B) / ant(6)-Ia / aph(3')-III / VanHAX	-	1657..37875	36218

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin YoeB (5-85)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (1-72)

Sequences

Toxin

Protein

• Length: 86 a.a.
• Molecular weight: 10206.53 Da
• Isoelectric Point: 8.4369

>T288216 WP_000588503.1 NZ_LR135446:36071-36328 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Nucleotide

• Length: 258 bp

Antitoxin

Protein

• Length: 90 a.a.
• Molecular weight: 10373.51 Da
• Isoelectric Point: 4.4346

>AT288216 WP_000388479.1 NZ_LR135446:35809-36078 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Nucleotide

• Length: 270 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A828ZXQ8

Antitoxin

Loading, please wait

• AlphaFold DB: A0A828ZWU7