Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 217293..217828 Replicon plasmid 2
Accession NZ_LR135444
Organism Enterococcus faecium isolate E7114

Toxin (Protein)


Gene name yoeB Uniprot ID R2PQC0
Locus tag FSA55_RS15150 Protein ID WP_002314366.1
Coordinates 217293..217565 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q3Y220
Locus tag FSA55_RS15155 Protein ID WP_002297422.1
Coordinates 217565..217828 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FSA55_RS15110 212399..212848 - 450 WP_010729386.1 TlpA disulfide reductase family protein -
FSA55_RS15115 213004..213546 - 543 WP_002298088.1 hypothetical protein -
FSA55_RS15120 213821..214464 + 644 Protein_230 transposase -
FSA55_RS15125 214540..215220 + 681 WP_002331383.1 IS6-like element IS1216 family transposase -
FSA55_RS15130 215279..215467 - 189 Protein_232 hypothetical protein -
FSA55_RS15135 215468..216325 - 858 WP_002292680.1 ParA family protein -
FSA55_RS15140 216611..216897 - 287 Protein_234 type II toxin-antitoxin system RelE/ParE family toxin -
FSA55_RS15145 216887..217216 - 330 WP_002292678.1 AbrB family transcriptional regulator -
FSA55_RS15150 217293..217565 - 273 WP_002314366.1 Txe/YoeB family addiction module toxin Toxin
FSA55_RS15155 217565..217828 - 264 WP_002297422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FSA55_RS15160 218062..218970 + 909 Protein_238 IS982-like element ISEfm1 family transposase -
FSA55_RS15165 218973..220148 - 1176 WP_002336205.1 MFS transporter -
FSA55_RS15170 220151..222400 - 2250 WP_127840794.1 alpha-galactosidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 211207..228429 17222
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..230681 230681


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10780.24 Da        Isoelectric Point: 9.9724

>T288214 WP_002314366.1 NZ_LR135444:c217565-217293 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9959.22 Da        Isoelectric Point: 4.5370

>AT288214 WP_002297422.1 NZ_LR135444:c217828-217565 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F704

Antitoxin

Source ID Structure
AlphaFold DB A0A829F006

References