Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 278572..279107 Replicon plasmid 2
Accession NZ_LR135358
Organism Enterococcus faecium isolate E7948

Toxin (Protein)


Gene name yoeB Uniprot ID R2PQC0
Locus tag EQB40_RS15070 Protein ID WP_002314366.1
Coordinates 278572..278844 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q3Y220
Locus tag EQB40_RS15075 Protein ID WP_002297422.1
Coordinates 278844..279107 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB40_RS15030 273741..274190 - 450 WP_010729386.1 TlpA family protein disulfide reductase -
EQB40_RS15785 274346..274888 - 543 WP_002298088.1 hypothetical protein -
EQB40_RS15045 275163..275806 + 644 Protein_280 transposase -
EQB40_RS15050 275882..276562 + 681 WP_002331383.1 IS6-like element IS1216 family transposase -
EQB40_RS15790 276596..276745 - 150 WP_164853348.1 hypothetical protein -
EQB40_RS15055 276746..277603 - 858 WP_002292680.1 AAA family ATPase -
EQB40_RS15060 277889..278176 - 288 WP_002300557.1 type II toxin-antitoxin system RelE/ParE family toxin -
EQB40_RS15065 278166..278495 - 330 WP_002292678.1 AbrB family transcriptional regulator -
EQB40_RS15070 278572..278844 - 273 WP_002314366.1 Txe/YoeB family addiction module toxin Toxin
EQB40_RS15075 278844..279107 - 264 WP_002297422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB40_RS15080 279341..280249 + 909 Protein_288 IS982 family transposase -
EQB40_RS15085 280252..281427 - 1176 WP_002336205.1 MFS transporter -
EQB40_RS15090 281430..283679 - 2250 WP_002314387.1 alpha-galactosidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid cfr(B) - 1..293851 293851
- inside IScluster/Tn - - 266183..291599 25416


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10780.24 Da        Isoelectric Point: 9.9724

>T288164 WP_002314366.1 NZ_LR135358:c278844-278572 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9959.22 Da        Isoelectric Point: 4.5370

>AT288164 WP_002297422.1 NZ_LR135358:c279107-278844 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F704

Antitoxin

Source ID Structure
AlphaFold DB A0A829F006

References