Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 137032..137567 Replicon plasmid 2
Accession NZ_LR135308
Organism Enterococcus faecium isolate E7240

Toxin (Protein)


Gene name yoeB Uniprot ID Q3Y221
Locus tag EQB75_RS16235 Protein ID WP_002305108.1
Coordinates 137032..137304 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A133CED7
Locus tag EQB75_RS16240 Protein ID WP_002303154.1
Coordinates 137304..137567 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB75_RS16205 132280..133239 - 960 WP_002303350.1 IS30 family transposase -
EQB75_RS16210 133413..134360 + 948 WP_002303155.1 DNA-binding transcriptional regulator -
EQB75_RS16215 134657..135205 - 549 WP_002292681.1 hypothetical protein -
EQB75_RS16220 135206..136063 - 858 WP_002292680.1 AAA family ATPase -
EQB75_RS16225 136349..136636 - 288 WP_002300557.1 type II toxin-antitoxin system RelE/ParE family toxin -
EQB75_RS16230 136626..136955 - 330 WP_002292678.1 AbrB family transcriptional regulator -
EQB75_RS16235 137032..137304 - 273 WP_002305108.1 Txe/YoeB family addiction module toxin Toxin
EQB75_RS16240 137304..137567 - 264 WP_002303154.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB75_RS16245 137673..138089 - 417 WP_002303153.1 hypothetical protein -
EQB75_RS16250 138095..138658 - 564 Protein_148 IS6 family transposase -
EQB75_RS16255 138738..139900 + 1163 WP_086956687.1 IS3 family transposase -
EQB75_RS16260 140372..140761 - 390 Protein_150 aldose 1-epimerase family protein -
EQB75_RS16265 140817..141497 - 681 WP_002319817.1 IS6-like element ISS1N family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..156709 156709
- inside IScluster/Tn - - 132280..154457 22177


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10806.28 Da        Isoelectric Point: 9.9080

>T288128 WP_002305108.1 NZ_LR135308:c137304-137032 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTYEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9886.16 Da        Isoelectric Point: 4.5370

>AT288128 WP_002303154.1 NZ_LR135308:c137567-137304 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDLKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A133CER3

Antitoxin

Source ID Structure
AlphaFold DB A0A133CED7

References