Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 218263..218798 Replicon plasmid 2
Accession NZ_LR135279
Organism Enterococcus faecium isolate E6975

Toxin (Protein)


Gene name yoeB Uniprot ID R2PQC0
Locus tag EQB65_RS16415 Protein ID WP_002314366.1
Coordinates 218263..218535 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q3Y220
Locus tag EQB65_RS16420 Protein ID WP_002297422.1
Coordinates 218535..218798 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB65_RS16370 213369..213818 - 450 WP_010729386.1 TlpA family protein disulfide reductase -
EQB65_RS17555 213974..214516 - 543 WP_002298088.1 hypothetical protein -
EQB65_RS16385 214791..215434 + 644 Protein_232 transposase -
EQB65_RS16390 215510..216190 + 681 WP_002331383.1 IS6-like element IS1216 family transposase -
EQB65_RS16395 216249..216437 - 189 Protein_234 hypothetical protein -
EQB65_RS16400 216438..217295 - 858 WP_002292680.1 AAA family ATPase -
EQB65_RS16405 217581..217867 - 287 Protein_236 type II toxin-antitoxin system RelE/ParE family toxin -
EQB65_RS16410 217857..218186 - 330 WP_002292678.1 AbrB family transcriptional regulator -
EQB65_RS16415 218263..218535 - 273 WP_002314366.1 Txe/YoeB family addiction module toxin Toxin
EQB65_RS16420 218535..218798 - 264 WP_002297422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB65_RS16425 219032..219940 + 909 Protein_240 IS982 family transposase -
EQB65_RS16430 219943..221118 - 1176 WP_002336205.1 MFS transporter -
EQB65_RS16435 221121..223370 - 2250 WP_127840794.1 alpha-galactosidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..231651 231651
- inside IScluster/Tn - - 212177..229399 17222


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10780.24 Da        Isoelectric Point: 9.9724

>T288112 WP_002314366.1 NZ_LR135279:c218535-218263 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9959.22 Da        Isoelectric Point: 4.5370

>AT288112 WP_002297422.1 NZ_LR135279:c218798-218535 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F704

Antitoxin

Source ID Structure
AlphaFold DB A0A829F006

References