Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 108594..109129 Replicon plasmid 2
Accession NZ_LR135182
Organism Enterococcus faecium isolate E1774

Toxin (Protein)


Gene name yoeB Uniprot ID R2PQC0
Locus tag EL353_RS14385 Protein ID WP_002314366.1
Coordinates 108594..108866 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q3Y220
Locus tag EL353_RS14390 Protein ID WP_002297422.1
Coordinates 108866..109129 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL353_RS14350 104593..105210 - 618 WP_002376250.1 hypothetical protein -
EL353_RS14355 105272..105952 - 681 Protein_110 IS6 family transposase -
EL353_RS14365 106219..106767 - 549 WP_002292681.1 hypothetical protein -
EL353_RS14370 106768..107625 - 858 WP_002292680.1 AAA family ATPase -
EL353_RS14375 107911..108198 - 288 WP_002345819.1 type II toxin-antitoxin system RelE/ParE family toxin -
EL353_RS14380 108188..108517 - 330 WP_002292678.1 AbrB family transcriptional regulator -
EL353_RS14385 108594..108866 - 273 WP_002314366.1 Txe/YoeB family addiction module toxin Toxin
EL353_RS14390 108866..109129 - 264 WP_002297422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL353_RS14395 109235..109612 - 378 WP_061343365.1 hypothetical protein -
EL353_RS14400 109975..110934 - 960 WP_002301399.1 IS30 family transposase -
EL353_RS14405 111029..111226 - 198 Protein_119 hypothetical protein -
EL353_RS14410 111688..112368 - 681 WP_002331383.1 IS6-like element IS1216 family transposase -
EL353_RS14415 112444..112638 - 195 Protein_121 transposase -
EL353_RS14420 112715..112924 + 210 Protein_122 ATP-dependent protease -
EL353_RS14425 113122..113718 - 597 WP_080251180.1 YdhK family protein -
EL353_RS14430 113739..113945 - 207 WP_002307659.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..167526 167526
- inside IScluster/Tn - - 86508..112638 26130


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10780.24 Da        Isoelectric Point: 9.9724

>T288052 WP_002314366.1 NZ_LR135182:c108866-108594 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9959.22 Da        Isoelectric Point: 4.5370

>AT288052 WP_002297422.1 NZ_LR135182:c109129-108866 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F704

Antitoxin

Source ID Structure
AlphaFold DB A0A829F006

References