Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 1813039..1813664 Replicon chromosome
Accession NZ_LR134536
Organism Staphylococcus epidermidis strain NCTC13924

Toxin (Protein)


Gene name doc Uniprot ID Q5HMS9
Locus tag EL299_RS09020 Protein ID WP_002504557.1
Coordinates 1813039..1813434 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A4Y7VKS9
Locus tag EL299_RS09025 Protein ID WP_002504558.1
Coordinates 1813434..1813664 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL299_RS08985 1808707..1809111 + 405 WP_002504535.1 YolD-like family protein -
EL299_RS08990 1809359..1810000 - 642 WP_002504537.1 hypothetical protein -
EL299_RS08995 1810106..1810828 - 723 WP_002504538.1 hypothetical protein -
EL299_RS09000 1810937..1811737 - 801 WP_000686449.1 metallophosphoesterase -
EL299_RS09005 1811741..1812235 - 495 WP_010959224.1 hypothetical protein -
EL299_RS09010 1812292..1812561 - 270 WP_000755772.1 hypothetical protein -
EL299_RS09015 1812545..1812736 - 192 WP_002504556.1 hypothetical protein -
EL299_RS09020 1813039..1813434 - 396 WP_002504557.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL299_RS09025 1813434..1813664 - 231 WP_002504558.1 addiction module antitoxin Antitoxin
EL299_RS09030 1813827..1814345 - 519 WP_002504559.1 metallophosphoesterase -
EL299_RS09035 1814345..1814995 - 651 WP_002504560.1 hypothetical protein -
EL299_RS09040 1814995..1815312 - 318 WP_002504561.1 hypothetical protein -
EL299_RS09045 1815305..1816030 - 726 WP_010959229.1 metallophosphoesterase -
EL299_RS09050 1816030..1816251 - 222 WP_002504563.1 hypothetical protein -
EL299_RS14170 1816271..1816447 - 177 WP_002504564.1 hypothetical protein -
EL299_RS09055 1816440..1816982 - 543 WP_002504565.1 hypothetical protein -
EL299_RS09060 1816998..1817270 - 273 WP_002504566.1 hypothetical protein -
EL299_RS09065 1817296..1817451 - 156 WP_002504567.1 transcriptional activator RinB -
EL299_RS09070 1817448..1817732 - 285 WP_002504568.1 hypothetical protein -
EL299_RS09075 1817748..1817933 - 186 WP_001187008.1 hypothetical protein -
EL299_RS09080 1817918..1818097 - 180 WP_002504569.1 hypothetical protein -
EL299_RS09085 1818113..1818595 - 483 WP_002504570.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage aac(6')-aph(2'') - 1781467..1913932 132465


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14992.31 Da        Isoelectric Point: 9.4885

>T288032 WP_002504557.1 NZ_LR134536:c1813434-1813039 [Staphylococcus epidermidis]
MQSTKYLTEKQVIAINVKAIQDFSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFHNANKR
TAFTSMVIFLKLNSINFECTQDEAVQFTLRVVNDKNLTLEGIETWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8648.89 Da        Isoelectric Point: 5.1231

>AT288032 WP_002504558.1 NZ_LR134536:c1813664-1813434 [Staphylococcus epidermidis]
MITTRKLRKAGNSSVVSVPTEVIAALGISNGDNLKFNVKDNKVTIEKEVREDEEFFKLLDETFTEYNQALKRMVDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Y7VKP2

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y7VKS9

References