Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1540378..1541005 | Replicon | chromosome |
| Accession | NZ_LR134529 | ||
| Organism | Bartonella vinsonii strain NCTC12905 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL291_RS06970 | Protein ID | WP_126603699.1 |
| Coordinates | 1540691..1541005 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | EL291_RS06965 | Protein ID | WP_019220222.1 |
| Coordinates | 1540378..1540674 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL291_RS06925 | 1535867..1536187 | + | 321 | WP_126604052.1 | hypothetical protein | - |
| EL291_RS06930 | 1536191..1536775 | + | 585 | WP_197721505.1 | hypothetical protein | - |
| EL291_RS06945 | 1537569..1538285 | + | 717 | WP_126603695.1 | heat-labile enterotoxin subunit alpha | - |
| EL291_RS06950 | 1538613..1538912 | + | 300 | WP_126603696.1 | hypothetical protein | - |
| EL291_RS06955 | 1539317..1540057 | + | 741 | WP_126603697.1 | phage regulatory protein/antirepressor Ant | - |
| EL291_RS06960 | 1540054..1540332 | + | 279 | WP_126603698.1 | hypothetical protein | - |
| EL291_RS06965 | 1540378..1540674 | - | 297 | WP_019220222.1 | HigA family addiction module antidote protein | Antitoxin |
| EL291_RS06970 | 1540691..1541005 | - | 315 | WP_126603699.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL291_RS06975 | 1541068..1541616 | + | 549 | WP_126603700.1 | hypothetical protein | - |
| EL291_RS06980 | 1541606..1543552 | + | 1947 | WP_126603701.1 | phage terminase large subunit family protein | - |
| EL291_RS06985 | 1543556..1543804 | + | 249 | WP_126603702.1 | hypothetical protein | - |
| EL291_RS06990 | 1543804..1545348 | + | 1545 | WP_126603703.1 | phage portal protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1521516..1575974 | 54458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12121.90 Da Isoelectric Point: 9.0985
>T288016 WP_126603699.1 NZ_LR134529:c1541005-1540691 [Bartonella vinsonii]
MIHKRTNEGDLVIESFADKRCKDLLEGNPPRGFPSTLVRIAQRKLFMLDKAVDLKDLRSPPGNRLEALKGERKGQYSIRI
NDQFRICFEWRSNGAYEVEIVDYH
MIHKRTNEGDLVIESFADKRCKDLLEGNPPRGFPSTLVRIAQRKLFMLDKAVDLKDLRSPPGNRLEALKGERKGQYSIRI
NDQFRICFEWRSNGAYEVEIVDYH
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|