Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ(toxin) |
Location | 1389433..1390021 | Replicon | chromosome |
Accession | NZ_LR134519 | ||
Organism | Helicobacter pylori strain NCTC12823 |
Toxin (Protein)
Gene name | TfiT | Uniprot ID | - |
Locus tag | EL264_RS06740 | Protein ID | WP_126474679.1 |
Coordinates | 1389433..1389714 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | TfiA | Uniprot ID | A0A0B2EMJ7 |
Locus tag | EL264_RS06745 | Protein ID | WP_042633499.1 |
Coordinates | 1389707..1390021 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL264_RS06705 (NCTC12823_01335) | 1384633..1384896 | + | 264 | WP_126474675.1 | hypothetical protein | - |
EL264_RS06710 (NCTC12823_01336) | 1384893..1385192 | + | 300 | WP_001974502.1 | hypothetical protein | - |
EL264_RS06715 (NCTC12823_01337) | 1385192..1386133 | + | 942 | WP_126474676.1 | ATPase, T2SS/T4P/T4SS family | - |
EL264_RS06720 (NCTC12823_01338) | 1386130..1386585 | + | 456 | WP_126474677.1 | mobilization protein | - |
EL264_RS06725 (NCTC12823_01339) | 1386582..1386872 | + | 291 | WP_097692878.1 | hypothetical protein | - |
EL264_RS06730 (NCTC12823_01340) | 1386873..1387430 | + | 558 | WP_126474678.1 | hypothetical protein | - |
EL264_RS06735 (NCTC12823_01341) | 1387431..1389158 | + | 1728 | WP_164757155.1 | type IV secretory system conjugative DNA transfer family protein | - |
EL264_RS06740 (NCTC12823_01342) | 1389433..1389714 | - | 282 | WP_126474679.1 | YafQ family addiction module toxin | Toxin |
EL264_RS06745 (NCTC12823_01343) | 1389707..1390021 | - | 315 | WP_042633499.1 | hypothetical protein | Antitoxin |
EL264_RS06750 | 1390305..1392217 | + | 1913 | Protein_1261 | relaxase | - |
EL264_RS06755 (NCTC12823_01346) | 1392242..1393432 | - | 1191 | WP_126474680.1 | hypothetical protein | - |
EL264_RS06760 (NCTC12823_01347) | 1393476..1393760 | - | 285 | WP_000394655.1 | hypothetical protein | - |
EL264_RS06765 (NCTC12823_01348) | 1393842..1394498 | - | 657 | WP_126474681.1 | ParA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10958.98 Da Isoelectric Point: 9.8257
>T288000 WP_126474679.1 NZ_LR134519:c1389714-1389433 [Helicobacter pylori]
MLKVRTKKDFLKDFNKHILSGRIKESDIISIVDCLKEQKPLQQKYCDHALSGNLKGLRECHVKPNLLLIYEIKKQENELV
LLRLDTHSELFKK
MLKVRTKKDFLKDFNKHILSGRIKESDIISIVDCLKEQKPLQQKYCDHALSGNLKGLRECHVKPNLLLIYEIKKQENELV
LLRLDTHSELFKK
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|