Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1813852..1814640 | Replicon | chromosome |
| Accession | NZ_LR134514 | ||
| Organism | Pasteurella multocida subsp. septica strain NCTC11619 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2J9QLH7 |
| Locus tag | EL252_RS08345 | Protein ID | WP_005725755.1 |
| Coordinates | 1813852..1814178 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL252_RS08350 | Protein ID | WP_005757699.1 |
| Coordinates | 1814314..1814640 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL252_RS08320 | 1809170..1809856 | + | 687 | WP_104227953.1 | hypothetical protein | - |
| EL252_RS08325 | 1809910..1811439 | - | 1530 | WP_108511680.1 | YifB family Mg chelatase-like AAA ATPase | - |
| EL252_RS08330 | 1811547..1812164 | - | 618 | WP_005724253.1 | ribosome biogenesis GTP-binding protein YihA/YsxC | - |
| EL252_RS08335 | 1812275..1813144 | + | 870 | WP_005724254.1 | VirK/YbjX family protein | - |
| EL252_RS08340 | 1813218..1813694 | - | 477 | WP_042742721.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| EL252_RS08345 | 1813852..1814178 | + | 327 | WP_005725755.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL252_RS08350 | 1814314..1814640 | + | 327 | WP_005757699.1 | HigA family addiction module antidote protein | Antitoxin |
| EL252_RS08355 | 1814695..1816215 | - | 1521 | WP_126417733.1 | DUF560 domain-containing protein | - |
| EL252_RS08360 | 1816274..1816864 | - | 591 | WP_108511676.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| EL252_RS08365 | 1817136..1818167 | - | 1032 | WP_104884166.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12892.73 Da Isoelectric Point: 9.6705
>T287985 WP_005725755.1 NZ_LR134514:1813852-1814178 [Pasteurella multocida subsp. septica]
MDRVRFNLTEDSFQDKYLYEYFLYGSKHKNIPSDIENTLAHKLDMLDSANTLSDLRSPPGNKLEKLEPKTSGLYSIRVNV
KYRLIFKYKESNFPKITELRLDKHQYRL
MDRVRFNLTEDSFQDKYLYEYFLYGSKHKNIPSDIENTLAHKLDMLDSANTLSDLRSPPGNKLEKLEPKTSGLYSIRVNV
KYRLIFKYKESNFPKITELRLDKHQYRL
Download Length: 327 bp
Antitoxin
Download Length: 109 a.a. Molecular weight: 12377.41 Da Isoelectric Point: 7.2034
>AT287985 WP_005757699.1 NZ_LR134514:1814314-1814640 [Pasteurella multocida subsp. septica]
MSRVQRKPSTVGDILLDEYLVPLNLKIADLATMLDVHRNTASALVNNNTKLSLEMALKLAKLFNTSPEFWLNLQMKLDLW
EIENNARFQESLKKISSIDQHNLLEKIA
MSRVQRKPSTVGDILLDEYLVPLNLKIADLATMLDVHRNTASALVNNNTKLSLEMALKLAKLFNTSPEFWLNLQMKLDLW
EIENNARFQESLKKISSIDQHNLLEKIA
Download Length: 327 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|