Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1303568..1304207 | Replicon | chromosome |
Accession | NZ_LR134490 | ||
Organism | Haemophilus influenzae strain NCTC11873 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL230_RS06450 | Protein ID | WP_118806538.1 |
Coordinates | 1303568..1303873 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL230_RS06455 | Protein ID | WP_005650217.1 |
Coordinates | 1303884..1304207 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL230_RS06430 | 1298999..1301038 | - | 2040 | WP_075985258.1 | excinuclease ABC subunit B | - |
EL230_RS06440 | 1301652..1302620 | - | 969 | WP_118806537.1 | zinc transporter permease subunit ZevB | - |
EL230_RS06445 | 1302623..1303243 | - | 621 | WP_110432017.1 | zinc transporter binding subunit ZevA | - |
EL230_RS06450 | 1303568..1303873 | + | 306 | WP_118806538.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL230_RS06455 | 1303884..1304207 | + | 324 | WP_005650217.1 | HigA family addiction module antidote protein | Antitoxin |
EL230_RS06460 | 1304370..1306040 | + | 1671 | WP_005650218.1 | energy-dependent translational throttle protein EttA | - |
EL230_RS06465 | 1306102..1306443 | + | 342 | WP_005666735.1 | SirB2 family protein | - |
EL230_RS06470 | 1306448..1308418 | + | 1971 | WP_005666737.1 | tRNA(Met) cytidine acetyltransferase TmcA | - |
EL230_RS09815 | 1308415..1308588 | + | 174 | WP_005637028.1 | DUF5363 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12271.91 Da Isoelectric Point: 9.0853
>T287952 WP_118806538.1 NZ_LR134490:1303568-1303873 [Haemophilus influenzae]
MFNLKREHFRDDYLYRFYQYGDAHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDAHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|