Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 352709..353367 | Replicon | chromosome |
Accession | NZ_LR134490 | ||
Organism | Haemophilus influenzae strain NCTC11873 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL230_RS01795 | Protein ID | WP_126513432.1 |
Coordinates | 352709..353056 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL230_RS01800 | Protein ID | WP_126513433.1 |
Coordinates | 353053..353367 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL230_RS01770 | 348540..348911 | + | 372 | WP_126513427.1 | hypothetical protein | - |
EL230_RS01775 | 348901..349104 | + | 204 | WP_126513428.1 | hypothetical protein | - |
EL230_RS01780 | 349091..349612 | + | 522 | WP_126513429.1 | hypothetical protein | - |
EL230_RS01785 | 349605..349997 | + | 393 | WP_126513430.1 | hypothetical protein | - |
EL230_RS01790 | 349985..352177 | + | 2193 | WP_126513431.1 | DUF927 domain-containing protein | - |
EL230_RS01795 | 352709..353056 | + | 348 | WP_126513432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL230_RS01800 | 353053..353367 | + | 315 | WP_126513433.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EL230_RS01805 | 353508..354596 | + | 1089 | WP_105876175.1 | ATP-binding protein | - |
EL230_RS01810 | 354897..357482 | - | 2586 | WP_126513434.1 | DNA mismatch repair protein MutS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13393.27 Da Isoelectric Point: 9.6118
>T287946 WP_126513432.1 NZ_LR134490:352709-353056 [Haemophilus influenzae]
MKLAFVELPFFEKYRAEYLSDDEYRALQNELLENPEKGDLIQGSNGLRKIRVANSKRNKGKRGGARAIYYYYINNQTIYF
FTIYGKETKDDLKPEELKVLAQLANSIKKITGETQ
MKLAFVELPFFEKYRAEYLSDDEYRALQNELLENPEKGDLIQGSNGLRKIRVANSKRNKGKRGGARAIYYYYINNQTIYF
FTIYGKETKDDLKPEELKVLAQLANSIKKITGETQ
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|