Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4441966..4442636 | Replicon | chromosome |
| Accession | NZ_LR134485 | ||
| Organism | Citrobacter youngae strain NCTC13709 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A6N6JXY6 |
| Locus tag | EL296_RS22005 | Protein ID | WP_046671374.1 |
| Coordinates | 4442334..4442636 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL296_RS22000 | Protein ID | WP_048213890.1 |
| Coordinates | 4441966..4442307 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11819.43 Da Isoelectric Point: 9.9581
>T287940 WP_046671374.1 NZ_LR134485:c4442636-4442334 [Citrobacter youngae]
MSKSLNIRSFRDTWLEDFFERATSHRKIPADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
MSKSLNIRSFRDTWLEDFFERATSHRKIPADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|