Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4441966..4442636 | Replicon | chromosome |
Accession | NZ_LR134485 | ||
Organism | Citrobacter youngae strain NCTC13709 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6N6JXY6 |
Locus tag | EL296_RS22005 | Protein ID | WP_046671374.1 |
Coordinates | 4442334..4442636 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL296_RS22000 | Protein ID | WP_048213890.1 |
Coordinates | 4441966..4442307 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL296_RS21970 | 4437587..4438345 | + | 759 | WP_048213884.1 | phosphonate C-P lyase system protein PhnK | - |
EL296_RS21975 | 4438355..4439035 | + | 681 | WP_124021050.1 | phosphonate C-P lyase system protein PhnL | - |
EL296_RS21980 | 4439032..4440168 | + | 1137 | WP_124021051.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
EL296_RS21985 | 4440171..4440725 | + | 555 | WP_124021052.1 | ribose 1,5-bisphosphokinase | - |
EL296_RS21990 | 4440712..4441146 | + | 435 | WP_124021053.1 | aminoalkylphosphonate N-acetyltransferase | - |
EL296_RS21995 | 4441155..4441913 | + | 759 | WP_124021054.1 | phosphonate metabolism protein PhnP | - |
EL296_RS22000 | 4441966..4442307 | - | 342 | WP_048213890.1 | HigA family addiction module antidote protein | Antitoxin |
EL296_RS22005 | 4442334..4442636 | - | 303 | WP_046671374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL296_RS22010 | 4442792..4443121 | - | 330 | WP_124021055.1 | hypothetical protein | - |
EL296_RS22015 | 4443191..4445455 | - | 2265 | WP_124021056.1 | hybrid sensor histidine kinase/response regulator | - |
EL296_RS22025 | 4445570..4447093 | + | 1524 | WP_124021057.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11819.43 Da Isoelectric Point: 9.9581
>T287940 WP_046671374.1 NZ_LR134485:c4442636-4442334 [Citrobacter youngae]
MSKSLNIRSFRDTWLEDFFERATSHRKIPADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
MSKSLNIRSFRDTWLEDFFERATSHRKIPADIHTALARKLDIINAAVSHRDLRSPPGNRYEELTGKLQEYSSIRVNKQYR
LIFKWVNGKAEDVYLDPHIY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|