Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 840461..841147 | Replicon | chromosome |
Accession | NZ_LR134482 | ||
Organism | Pseudomonas stutzeri strain NCTC10475 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL330_RS03860 | Protein ID | WP_101275056.1 |
Coordinates | 840461..840814 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W9TFC1 |
Locus tag | EL330_RS03865 | Protein ID | WP_037038764.1 |
Coordinates | 840818..841147 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL330_RS03820 | 835678..836334 | + | 657 | WP_126514543.1 | hypothetical protein | - |
EL330_RS03830 | 836880..837098 | + | 219 | WP_014852368.1 | hypothetical protein | - |
EL330_RS03835 | 837095..837310 | + | 216 | WP_045666264.1 | hypothetical protein | - |
EL330_RS20940 | 837303..837692 | + | 390 | WP_172602746.1 | hypothetical protein | - |
EL330_RS03845 | 837780..838079 | + | 300 | WP_101275058.1 | hypothetical protein | - |
EL330_RS03850 | 838149..839429 | + | 1281 | WP_101275057.1 | hypothetical protein | - |
EL330_RS03855 | 839429..840412 | + | 984 | WP_101275415.1 | tyrosine-type recombinase/integrase | - |
EL330_RS03860 | 840461..840814 | + | 354 | WP_101275056.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL330_RS03865 | 840818..841147 | + | 330 | WP_037038764.1 | XRE family transcriptional regulator | Antitoxin |
EL330_RS03875 | 841749..842054 | - | 306 | WP_101275055.1 | hypothetical protein | - |
EL330_RS03880 | 842236..845088 | - | 2853 | WP_101275054.1 | FAD-binding oxidoreductase | - |
EL330_RS03885 | 845085..845756 | - | 672 | WP_038663056.1 | lactate utilization protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13520.87 Da Isoelectric Point: 4.6682
>T287928 WP_101275056.1 NZ_LR134482:840461-840814 [Pseudomonas stutzeri]
MTWDVEYTDEFGDWWESLTADEQESIAVSVHLLEDRGPSLGFPHSSAINGSRHGHMRELRTQHNGRPIRTLYAFDPRRSA
ILLIGGDKTGDNRWYEINVPLADRLYDEHLEQLEKEG
MTWDVEYTDEFGDWWESLTADEQESIAVSVHLLEDRGPSLGFPHSSAINGSRHGHMRELRTQHNGRPIRTLYAFDPRRSA
ILLIGGDKTGDNRWYEINVPLADRLYDEHLEQLEKEG
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|