Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1604826..1605495 | Replicon | chromosome |
| Accession | NZ_LR134481 | ||
| Organism | Haemophilus parainfluenzae strain NCTC10665 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL215_RS08035 | Protein ID | WP_126471368.1 |
| Coordinates | 1605112..1605495 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A502K5Z3 |
| Locus tag | EL215_RS08030 | Protein ID | WP_005651224.1 |
| Coordinates | 1604826..1605128 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL215_RS08010 | 1600070..1600783 | - | 714 | WP_126471364.1 | phage minor tail protein L | - |
| EL215_RS08015 | 1600783..1601109 | - | 327 | WP_118867633.1 | phage tail protein | - |
| EL215_RS08020 | 1601109..1604522 | - | 3414 | WP_126471366.1 | tape measure protein | - |
| EL215_RS08030 | 1604826..1605128 | - | 303 | WP_005651224.1 | XRE family transcriptional regulator | Antitoxin |
| EL215_RS08035 | 1605112..1605495 | - | 384 | WP_126471368.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL215_RS08040 | 1605564..1605788 | - | 225 | WP_118809166.1 | DUF4035 domain-containing protein | - |
| EL215_RS08045 | 1605833..1606240 | - | 408 | WP_126471370.1 | hypothetical protein | - |
| EL215_RS08050 | 1606298..1606951 | - | 654 | WP_126471372.1 | hypothetical protein | - |
| EL215_RS08055 | 1606954..1607364 | - | 411 | WP_005651206.1 | phage tail protein | - |
| EL215_RS08060 | 1607373..1607903 | - | 531 | WP_126471374.1 | phage tail protein | - |
| EL215_RS08065 | 1607906..1608217 | - | 312 | WP_126471376.1 | hypothetical protein | - |
| EL215_RS08070 | 1608198..1608521 | - | 324 | WP_126471378.1 | DUF2190 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14926.28 Da Isoelectric Point: 5.0181
>T287927 WP_126471368.1 NZ_LR134481:c1605495-1605112 [Haemophilus parainfluenzae]
MKQEWEVILQDPLLNWLKMLAEDDVLKIYAALELLSTEGPQLSRPYADTLQSSKYTNLKELRVQSKLSVFRLFYIFDPVR
QAIVLCGGDKKGKKEKLFYKEMIALAEQTYDDYLSELTKEQENERKI
MKQEWEVILQDPLLNWLKMLAEDDVLKIYAALELLSTEGPQLSRPYADTLQSSKYTNLKELRVQSKLSVFRLFYIFDPVR
QAIVLCGGDKKGKKEKLFYKEMIALAEQTYDDYLSELTKEQENERKI
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|