Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1809877..1810490 | Replicon | chromosome |
Accession | NZ_LR134480 | ||
Organism | Bordetella bronchiseptica strain NCTC8344 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0MEM3 |
Locus tag | EL399_RS08550 | Protein ID | WP_003811545.1 |
Coordinates | 1809877..1810188 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL399_RS08555 | Protein ID | WP_003811547.1 |
Coordinates | 1810191..1810490 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL399_RS08525 | 1805201..1805980 | + | 780 | WP_033454573.1 | SDR family oxidoreductase | - |
EL399_RS08530 | 1806093..1807019 | + | 927 | WP_033461661.1 | tripartite tricarboxylate transporter substrate binding protein | - |
EL399_RS08535 | 1807105..1808049 | + | 945 | WP_080702971.1 | LysR family transcriptional regulator | - |
EL399_RS08540 | 1808027..1808896 | - | 870 | WP_010930493.1 | TauD/TfdA family dioxygenase | - |
EL399_RS08545 | 1809140..1809763 | + | 624 | WP_003811542.1 | glutathione S-transferase family protein | - |
EL399_RS08550 | 1809877..1810188 | + | 312 | WP_003811545.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL399_RS08555 | 1810191..1810490 | + | 300 | WP_003811547.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL399_RS08560 | 1810504..1813580 | - | 3077 | Protein_1684 | autotransporter SphB2 | - |
EL399_RS08565 | 1813710..1814384 | + | 675 | WP_033449912.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11810.72 Da Isoelectric Point: 8.8245
>T287924 WP_003811545.1 NZ_LR134480:1809877-1810188 [Bordetella bronchiseptica]
MEFIETPIFTQLITALLSDEEYSRLQQLLIDNPERGDLLRGGGGIRKMRYGRQGTGKRGGIRVIYYWISQDCQIYMLAAY
AKSKKINLTPDEIAALRELVKEL
MEFIETPIFTQLITALLSDEEYSRLQQLLIDNPERGDLLRGGGGIRKMRYGRQGTGKRGGIRVIYYWISQDCQIYMLAAY
AKSKKINLTPDEIAALRELVKEL
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|