Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 629345..630045 | Replicon | chromosome |
Accession | NZ_LR134480 | ||
Organism | Bordetella bronchiseptica strain NCTC8344 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | A0A0H3LPJ8 |
Locus tag | EL399_RS02975 | Protein ID | WP_003809515.1 |
Coordinates | 629345..629641 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q7VY40 |
Locus tag | EL399_RS02980 | Protein ID | WP_003809516.1 |
Coordinates | 629644..630045 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL399_RS02955 | 625641..626183 | + | 543 | WP_033469689.1 | MOSC domain-containing protein | - |
EL399_RS02960 | 626359..627423 | + | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
EL399_RS02965 | 627509..627955 | - | 447 | WP_003809511.1 | GFA family protein | - |
EL399_RS02970 | 628181..629062 | + | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
EL399_RS02975 | 629345..629641 | + | 297 | WP_003809515.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
EL399_RS02980 | 629644..630045 | + | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EL399_RS02985 | 630065..630301 | + | 237 | WP_003809519.1 | hypothetical protein | - |
EL399_RS02990 | 630309..630788 | + | 480 | WP_003809523.1 | disulfide bond formation protein B | - |
EL399_RS02995 | 630936..631451 | + | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
EL399_RS03000 | 631454..632644 | + | 1191 | WP_003809527.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
EL399_RS03005 | 632664..633701 | + | 1038 | WP_033454358.1 | threonylcarbamoyl-AMP synthase | - |
EL399_RS03010 | 633838..634860 | + | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10608.50 Da Isoelectric Point: 7.9291
>T287923 WP_003809515.1 NZ_LR134480:629345-629641 [Bordetella bronchiseptica]
MEKGTPHCKLPALKALVHAGQVRATYSALSGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAV
YLKLTVLDGVLIVSFKEL
MEKGTPHCKLPALKALVHAGQVRATYSALSGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAV
YLKLTVLDGVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT287923 WP_003809516.1 NZ_LR134480:629644-630045 [Bordetella bronchiseptica]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3LPJ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3LKS6 |