Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4670555..4671183 | Replicon | chromosome |
Accession | NZ_LR134478 | ||
Organism | Serratia plymuthica strain NCTC8015 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL316_RS22305 | Protein ID | WP_119805070.1 |
Coordinates | 4670555..4670845 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL316_RS22310 | Protein ID | WP_006320518.1 |
Coordinates | 4670860..4671183 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL316_RS22295 | 4667117..4669138 | + | 2022 | WP_126528807.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
EL316_RS22300 | 4669185..4670324 | - | 1140 | WP_006320522.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
EL316_RS22305 | 4670555..4670845 | + | 291 | WP_119805070.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL316_RS22310 | 4670860..4671183 | + | 324 | WP_006320518.1 | HigA family addiction module antidote protein | Antitoxin |
EL316_RS22315 | 4671176..4671688 | + | 513 | WP_006320516.1 | M48 family metallopeptidase | - |
EL316_RS22320 | 4671789..4672769 | + | 981 | WP_126528808.1 | Gfo/Idh/MocA family oxidoreductase | - |
EL316_RS22325 | 4672771..4673502 | + | 732 | WP_126528809.1 | glutamine amidotransferase | - |
EL316_RS22330 | 4673762..4674733 | + | 972 | WP_172603412.1 | TerC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11709.40 Da Isoelectric Point: 10.2350
>T287919 WP_119805070.1 NZ_LR134478:4670555-4670845 [Serratia plymuthica]
MIKSFRDRYLEKFYREGRRNRLIPSPLERQLARKLDILAAAQKECDLHHPTGNYYKRLSGPFQGWSSMRVNMQWRLMFQW
RHDAAEQIYLDPHQDT
MIKSFRDRYLEKFYREGRRNRLIPSPLERQLARKLDILAAAQKECDLHHPTGNYYKRLSGPFQGWSSMRVNMQWRLMFQW
RHDAAEQIYLDPHQDT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|