Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4246071..4246723 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL316_RS20335 | Protein ID | WP_126528667.1 |
| Coordinates | 4246071..4246415 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2X4V2M0 |
| Locus tag | EL316_RS20340 | Protein ID | WP_063200237.1 |
| Coordinates | 4246421..4246723 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS20320 | 4243299..4244318 | + | 1020 | WP_004952299.1 | HTH-type transcriptional regulator GalR | - |
| EL316_RS20325 | 4244315..4244770 | - | 456 | WP_126528665.1 | GNAT family N-acetyltransferase | - |
| EL316_RS20330 | 4244922..4245932 | + | 1011 | WP_126528666.1 | LacI family DNA-binding transcriptional regulator | - |
| EL316_RS20335 | 4246071..4246415 | + | 345 | WP_126528667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL316_RS20340 | 4246421..4246723 | + | 303 | WP_063200237.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| EL316_RS20345 | 4246753..4248015 | - | 1263 | WP_126528668.1 | diaminopimelate decarboxylase | - |
| EL316_RS20350 | 4248152..4249075 | + | 924 | WP_126484900.1 | LysR family transcriptional regulator | - |
| EL316_RS20355 | 4249065..4250219 | - | 1155 | WP_126484902.1 | MFS transporter | - |
| EL316_RS20360 | 4250534..4251442 | - | 909 | WP_126484904.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13343.36 Da Isoelectric Point: 9.7587
>T287917 WP_126528667.1 NZ_LR134478:4246071-4246415 [Serratia plymuthica]
MWQVVTVERFDDWFLSLNSDEQKSLLAGIFKLQEFGPLLARPHADTLHFSGSIRHLKELRIQHHGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRLLPIAAMEFSHYLATQR
MWQVVTVERFDDWFLSLNSDEQKSLLAGIFKLQEFGPLLARPHADTLHFSGSIRHLKELRIQHHGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRLLPIAAMEFSHYLATQR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|