Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 976731..977246 | Replicon | chromosome |
Accession | NZ_LR134473 | ||
Organism | Acidipropionibacterium jensenii strain NCTC13652 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A3S4V1K2 |
Locus tag | EL292_RS04440 | Protein ID | WP_028702688.1 |
Coordinates | 976731..976985 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A3S4UWW3 |
Locus tag | EL292_RS04445 | Protein ID | WP_028702687.1 |
Coordinates | 976986..977246 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL292_RS04410 | 971797..972324 | - | 528 | WP_197720493.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
EL292_RS04415 | 972321..972698 | - | 378 | WP_051238192.1 | DUF1801 domain-containing protein | - |
EL292_RS14450 | 972785..973084 | - | 300 | WP_197720494.1 | hypothetical protein | - |
EL292_RS14455 | 973127..973384 | - | 258 | WP_197720495.1 | hypothetical protein | - |
EL292_RS04425 | 973401..975281 | - | 1881 | WP_197720511.1 | ABC transporter ATP-binding protein/permease | - |
EL292_RS04430 | 975325..975690 | - | 366 | WP_154655309.1 | hypothetical protein | - |
EL292_RS04435 | 975942..976481 | - | 540 | WP_028702689.1 | GNAT family N-acetyltransferase | - |
EL292_RS04440 | 976731..976985 | - | 255 | WP_028702688.1 | Txe/YoeB family addiction module toxin | Toxin |
EL292_RS04445 | 976986..977246 | - | 261 | WP_028702687.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
EL292_RS04450 | 977528..977920 | - | 393 | WP_197720512.1 | HigA family addiction module antidote protein | - |
EL292_RS04465 | 978335..978982 | - | 648 | WP_197720496.1 | TetR/AcrR family transcriptional regulator | - |
EL292_RS04470 | 979070..980827 | + | 1758 | WP_028702685.1 | oleate hydratase | - |
EL292_RS04475 | 981123..981602 | - | 480 | WP_197720497.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 981792..982796 | 1004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9970.31 Da Isoelectric Point: 7.2747
>T287889 WP_028702688.1 NZ_LR134473:c976985-976731 [Acidipropionibacterium jensenii]
VRLVWDPSAWEDYTHWQTIDRRVLKRVNTLIDSCLREPFAGIGKPEQLKYGAQGAWSRRITDEHRLVYLVDGDDLVILQA
RYHY
VRLVWDPSAWEDYTHWQTIDRRVLKRVNTLIDSCLREPFAGIGKPEQLKYGAQGAWSRRITDEHRLVYLVDGDDLVILQA
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S4V1K2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S4UWW3 |