Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 712573..713162 | Replicon | chromosome |
Accession | NZ_LR134442 | ||
Organism | Propionibacterium australiense strain NCTC13651 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | EL282_RS03085 | Protein ID | WP_119161924.1 |
Coordinates | 712573..712854 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL282_RS03090 | Protein ID | WP_119161923.1 |
Coordinates | 712863..713162 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL282_RS03055 | 708055..709911 | + | 1857 | WP_119161928.1 | ABC transporter ATP-binding protein/permease | - |
EL282_RS03060 | 710264..711337 | + | 1074 | WP_119161927.1 | redox-regulated ATPase YchF | - |
EL282_RS03070 | 711584..712012 | - | 429 | WP_119161926.1 | type II toxin-antitoxin system VapC family toxin | - |
EL282_RS03075 | 712009..712248 | - | 240 | WP_119161925.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EL282_RS03080 | 712368..712541 | + | 174 | Protein_606 | DUF933 domain-containing protein | - |
EL282_RS03085 | 712573..712854 | + | 282 | WP_119161924.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL282_RS03090 | 712863..713162 | + | 300 | WP_119161923.1 | HigA family addiction module antidote protein | Antitoxin |
EL282_RS03095 | 713301..713420 | + | 120 | Protein_609 | DUF933 domain-containing protein | - |
EL282_RS03100 | 713524..714777 | + | 1254 | WP_119161922.1 | ATP-binding protein | - |
EL282_RS03105 | 715171..716652 | + | 1482 | WP_119161921.1 | DUF3375 domain-containing protein | - |
EL282_RS03110 | 716645..717364 | + | 720 | WP_119161920.1 | DUF4194 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 698145..714777 | 16632 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10757.17 Da Isoelectric Point: 10.0891
>T287881 WP_119161924.1 NZ_LR134442:712573-712854 [Propionibacterium australiense]
VIRSFGDRDTELVWLREPARRIDPRVHKTANRKLHQLDAAVSLNSLRVPPGNHLEALRGDRKGQHSIRINDQWRICFVWT
AAGPENGIIEDYH
VIRSFGDRDTELVWLREPARRIDPRVHKTANRKLHQLDAAVSLNSLRVPPGNHLEALRGDRKGQHSIRINDQWRICFVWT
AAGPENGIIEDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|