Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 248668..249383 | Replicon | plasmid 9 |
| Accession | NZ_LR134418 | ||
| Organism | Legionella adelaidensis strain NCTC12735 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0W0R590 |
| Locus tag | EL206_RS02305 | Protein ID | WP_058461937.1 |
| Coordinates | 249096..249383 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0W0R5D5 |
| Locus tag | EL206_RS02300 | Protein ID | WP_058461936.1 |
| Coordinates | 248668..249093 (-) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL206_RS02260 | 243745..244542 | + | 798 | WP_058461118.1 | hypothetical protein | - |
| EL206_RS02265 | 244659..244904 | + | 246 | WP_058461117.1 | hypothetical protein | - |
| EL206_RS02275 | 245501..246675 | - | 1175 | Protein_212 | ISL3 family transposase | - |
| EL206_RS02280 | 246756..247226 | - | 471 | Protein_213 | site-specific integrase | - |
| EL206_RS02285 | 247290..247595 | + | 306 | WP_058462781.1 | transposase | - |
| EL206_RS02290 | 247592..248278 | + | 687 | WP_188331938.1 | IS3 family transposase | - |
| EL206_RS02295 | 248287..248427 | + | 141 | WP_188331939.1 | IS3 family transposase | - |
| EL206_RS02300 | 248668..249093 | - | 426 | WP_058461936.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL206_RS02305 | 249096..249383 | - | 288 | WP_058461937.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| EL206_RS09935 | 249448..250590 | - | 1143 | Protein_219 | integrase family protein | - |
| EL206_RS02320 | 250593..251024 | + | 432 | Protein_220 | DUF4143 domain-containing protein | - |
| EL206_RS02325 | 251192..251713 | - | 522 | WP_058461939.1 | hypothetical protein | - |
| EL206_RS02330 | 251704..252672 | - | 969 | WP_058461940.1 | hypothetical protein | - |
| EL206_RS02335 | 252968..253318 | + | 351 | WP_058461941.1 | DDE-type integrase/transposase/recombinase | - |
| EL206_RS02340 | 253441..254076 | + | 636 | WP_058461942.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pilE / ankH/legA3/ankW / pilT / enhA / lpg2359 / lpg2370 / lirB | 1..451287 | 451287 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11117.97 Da Isoelectric Point: 10.4175
>T287873 WP_058461937.1 NZ_LR134418:c249383-249096 [Legionella adelaidensis]
MHIITRRRITEAKALYPQCASALAGWLKVVEENEFKSFGELKAVFNSIDRVGGLFVFDIGGNKLRLIASIHFNRKKLYIR
HILTHQEYDKNKWKE
MHIITRRRITEAKALYPQCASALAGWLKVVEENEFKSFGELKAVFNSIDRVGGLFVFDIGGNKLRLIASIHFNRKKLYIR
HILTHQEYDKNKWKE
Download Length: 288 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 16082.06 Da Isoelectric Point: 4.5074
>AT287873 WP_058461936.1 NZ_LR134418:c249093-248668 [Legionella adelaidensis]
MTALAYNDYLEETIQHWKHISPIIHDPQNDDEYEKLASMLDQLLDVVGDNESHDLMGLVDVISHMITMYDENHDEQLQKG
SGIDALKFLMEQHGLDQSDLKDEIGSQGVVSEILNGKRQLNLSHIKKLAKRFHVTPATFID
MTALAYNDYLEETIQHWKHISPIIHDPQNDDEYEKLASMLDQLLDVVGDNESHDLMGLVDVISHMITMYDENHDEQLQKG
SGIDALKFLMEQHGLDQSDLKDEIGSQGVVSEILNGKRQLNLSHIKKLAKRFHVTPATFID
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0W0R590 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0W0R5D5 |