Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1480930..1481655 | Replicon | chromosome |
Accession | NZ_LR134396 | ||
Organism | Providencia rustigianii strain NCTC8113 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL244_RS06635 | Protein ID | WP_126459617.1 |
Coordinates | 1481350..1481655 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL244_RS06630 | Protein ID | WP_006813416.1 |
Coordinates | 1480930..1481346 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL244_RS06615 | 1476997..1477974 | + | 978 | WP_006813419.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
EL244_RS06620 | 1478113..1479756 | + | 1644 | WP_006813418.1 | flagellar hook-associated protein FlgK | - |
EL244_RS06625 | 1479805..1480740 | + | 936 | WP_039854240.1 | flagellar hook-associated protein FlgL | - |
EL244_RS06630 | 1480930..1481346 | - | 417 | WP_006813416.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL244_RS06635 | 1481350..1481655 | - | 306 | WP_126459617.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
EL244_RS06640 | 1481976..1482755 | - | 780 | WP_006813414.1 | flagellar type III secretion system protein FliR | - |
EL244_RS06645 | 1482758..1483027 | - | 270 | WP_126459620.1 | flagellar biosynthesis protein FliQ | - |
EL244_RS06650 | 1483036..1483779 | - | 744 | WP_006813412.1 | flagellar type III secretion system pore protein FliP | - |
EL244_RS06655 | 1483792..1484268 | - | 477 | WP_126459623.1 | flagellar biosynthetic protein FliO | - |
EL244_RS06660 | 1484270..1484686 | - | 417 | WP_006813410.1 | flagellar motor switch protein FliN | - |
EL244_RS06665 | 1484679..1485686 | - | 1008 | WP_006813409.1 | flagellar motor switch protein FliM | - |
EL244_RS06670 | 1485692..1486174 | - | 483 | WP_006813408.1 | flagellar basal body-associated protein FliL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12104.08 Da Isoelectric Point: 10.4596
>T287860 WP_126459617.1 NZ_LR134396:c1481655-1481350 [Providencia rustigianii]
MHVISREPFVHASERNPKHAKVLLDVYKTLKQGSYSSPDELKNIFPSLDRMKYREKWWVIDIGGNALRILFFADFKKSKI
FIKHISTHAEYNKLMNYYRRT
MHVISREPFVHASERNPKHAKVLLDVYKTLKQGSYSSPDELKNIFPSLDRMKYREKWWVIDIGGNALRILFFADFKKSKI
FIKHISTHAEYNKLMNYYRRT
Download Length: 306 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 16096.38 Da Isoelectric Point: 5.2536
>AT287860 WP_006813416.1 NZ_LR134396:c1481346-1480930 [Providencia rustigianii]
MIFSEAIQTANHLIHLIPILGKNHSRRDYEDAIKLVEYLVEYDPDNPLVEILCEKIDHYEDNAPEFADFNRKLKQCDDAV
AVLRTLMDQYNLNTTDFANEIGSRSYVSRILNGERNLSLEHMKKLAERFKLPVTIFIK
MIFSEAIQTANHLIHLIPILGKNHSRRDYEDAIKLVEYLVEYDPDNPLVEILCEKIDHYEDNAPEFADFNRKLKQCDDAV
AVLRTLMDQYNLNTTDFANEIGSRSYVSRILNGERNLSLEHMKKLAERFKLPVTIFIK
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|