Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 602987..603676 | Replicon | chromosome |
| Accession | NZ_LR134396 | ||
| Organism | Providencia rustigianii strain NCTC8113 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | D1P6V8 |
| Locus tag | EL244_RS02720 | Protein ID | WP_006815972.1 |
| Coordinates | 602987..603307 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL244_RS02725 | Protein ID | WP_039855724.1 |
| Coordinates | 603344..603676 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL244_RS02705 | 598219..599232 | + | 1014 | WP_006815975.1 | mechanosensitive ion channel family protein | - |
| EL244_RS02710 | 599505..601664 | + | 2160 | WP_126458567.1 | ornithine decarboxylase | - |
| EL244_RS02715 | 601764..602699 | + | 936 | WP_126458570.1 | nucleoside hydrolase | - |
| EL244_RS02720 | 602987..603307 | + | 321 | WP_006815972.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL244_RS02725 | 603344..603676 | + | 333 | WP_039855724.1 | HigA family addiction module antidote protein | Antitoxin |
| EL244_RS02730 | 603789..604814 | + | 1026 | WP_126458573.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| EL244_RS17875 | 604916..605089 | + | 174 | WP_172597495.1 | hypothetical protein | - |
| EL244_RS02735 | 605135..606118 | - | 984 | WP_126458576.1 | quinone oxidoreductase | - |
| EL244_RS02740 | 606328..607737 | + | 1410 | WP_006815966.1 | replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12700.77 Da Isoelectric Point: 8.4429
>T287856 WP_006815972.1 NZ_LR134396:602987-603307 [Providencia rustigianii]
MEEVYVNEDNDCRLIFRDEYLRLFYVYGKLHRLIPSIICTVLARKLDMLNAAKTLQDFKSPPGNRFKQLKPPLEEFYSIR
VNGQYRLIFKWKDTVEGLYLDPHKDV
MEEVYVNEDNDCRLIFRDEYLRLFYVYGKLHRLIPSIICTVLARKLDMLNAAKTLQDFKSPPGNRFKQLKPPLEEFYSIR
VNGQYRLIFKWKDTVEGLYLDPHKDV
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|