Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1666969..1667608 | Replicon | chromosome |
| Accession | NZ_LR134395 | ||
| Organism | Haemophilus aegyptius strain NCTC8134 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q4QJX7 |
| Locus tag | EL190_RS08715 | Protein ID | WP_005650215.1 |
| Coordinates | 1667303..1667608 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL190_RS08710 | Protein ID | WP_005650217.1 |
| Coordinates | 1666969..1667292 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL190_RS10255 | 1662589..1662762 | - | 174 | WP_005657572.1 | DUF5363 domain-containing protein | - |
| EL190_RS08695 | 1662759..1664729 | - | 1971 | WP_006995880.1 | tRNA(Met) cytidine acetyltransferase TmcA | - |
| EL190_RS08700 | 1664734..1665075 | - | 342 | WP_006995879.1 | SirB2 family protein | - |
| EL190_RS08705 | 1665136..1666806 | - | 1671 | WP_005663485.1 | energy-dependent translational throttle protein EttA | - |
| EL190_RS08710 | 1666969..1667292 | - | 324 | WP_005650217.1 | HigA family addiction module antidote protein | Antitoxin |
| EL190_RS08715 | 1667303..1667608 | - | 306 | WP_005650215.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL190_RS08720 | 1667933..1668553 | + | 621 | WP_005694310.1 | zinc transporter binding subunit ZevA | - |
| EL190_RS08725 | 1668556..1669530 | + | 975 | WP_006995878.1 | zinc transporter permease subunit ZevB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12301.93 Da Isoelectric Point: 9.0853
>T287855 WP_005650215.1 NZ_LR134395:c1667608-1667303 [Haemophilus aegyptius]
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
MFNLKREHFRDDYLYRFYQYGDTHSKIPSNLYKVLARKLDMISASENINDLRSPPANHLELLEPKENKIYSIRVNKQYRL
IFKYENNEVNNLYLDPHSYNL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|