Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1632204..1632847 | Replicon | chromosome |
Accession | NZ_LR134395 | ||
Organism | Haemophilus aegyptius strain NCTC8134 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL190_RS08560 | Protein ID | WP_006995912.1 |
Coordinates | 1632204..1632542 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL190_RS08565 | Protein ID | WP_006995911.1 |
Coordinates | 1632539..1632847 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL190_RS08535 | 1627814..1628185 | + | 372 | WP_006995917.1 | hypothetical protein | - |
EL190_RS08540 | 1628175..1628378 | + | 204 | WP_006995916.1 | hypothetical protein | - |
EL190_RS08545 | 1628365..1629048 | + | 684 | WP_006995915.1 | hypothetical protein | - |
EL190_RS08550 | 1629041..1629433 | + | 393 | WP_006995914.1 | hypothetical protein | - |
EL190_RS08555 | 1629421..1631613 | + | 2193 | WP_006995913.1 | DUF927 domain-containing protein | - |
EL190_RS08560 | 1632204..1632542 | + | 339 | WP_006995912.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL190_RS08565 | 1632539..1632847 | + | 309 | WP_006995911.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL190_RS08570 | 1633178..1633697 | - | 520 | Protein_1639 | DDE-type integrase/transposase/recombinase | - |
EL190_RS08575 | 1633769..1634443 | - | 675 | WP_006995908.1 | N-acylneuraminate cytidylyltransferase | - |
EL190_RS08580 | 1634557..1635219 | + | 663 | WP_006995907.1 | NAD(P)H-dependent oxidoreductase | - |
EL190_RS08585 | 1635258..1635611 | - | 354 | WP_006995906.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
EL190_RS08590 | 1635611..1635880 | - | 270 | WP_006995905.1 | hypothetical protein | - |
EL190_RS08595 | 1636103..1637215 | - | 1113 | WP_006995904.1 | iron-sulfur cluster carrier protein ApbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1620062..1632847 | 12785 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13134.05 Da Isoelectric Point: 9.2488
>T287854 WP_006995912.1 NZ_LR134395:1632204-1632542 [Haemophilus aegyptius]
VKLSFIELPPFERYRKAHLSDDEYRAFQNELLENPEKGDVIQNAGGLRKIRIADSERNKGKRGGARVIYYYLIRKSQILL
VTAYSKNRCEDLTTEQYKILAKLVKEIEELEQ
VKLSFIELPPFERYRKAHLSDDEYRAFQNELLENPEKGDVIQNAGGLRKIRIADSERNKGKRGGARVIYYYLIRKSQILL
VTAYSKNRCEDLTTEQYKILAKLVKEIEELEQ
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|