Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | HipBST/HipA-HipA |
| Location | 494664..496012 | Replicon | chromosome |
| Accession | NZ_LR134395 | ||
| Organism | Haemophilus aegyptius strain NCTC8134 | ||
Toxin (Protein)
| Gene name | HipT | Uniprot ID | - |
| Locus tag | EL190_RS02655 | Protein ID | WP_006995245.1 |
| Coordinates | 494981..496012 (+) | Length | 344 a.a. |
Antitoxin (Protein)
| Gene name | HipS | Uniprot ID | - |
| Locus tag | EL190_RS02650 | Protein ID | WP_006995246.1 |
| Coordinates | 494664..494984 (+) | Length | 107 a.a. |
Genomic Context
Location: 489887..490165 (279 bp)
Type: Others
Protein ID: WP_006995251.1
Type: Others
Protein ID: WP_006995251.1
Location: 490165..490842 (678 bp)
Type: Others
Protein ID: WP_006995250.1
Type: Others
Protein ID: WP_006995250.1
Location: 490839..491315 (477 bp)
Type: Others
Protein ID: WP_006995249.1
Type: Others
Protein ID: WP_006995249.1
Location: 493167..494168 (1002 bp)
Type: Others
Protein ID: WP_005672749.1
Type: Others
Protein ID: WP_005672749.1
Location: 494368..494676 (309 bp)
Type: Others
Protein ID: WP_005661200.1
Type: Others
Protein ID: WP_005661200.1
Location: 494664..494984 (321 bp)
Type: Antitoxin
Protein ID: WP_006995246.1
Type: Antitoxin
Protein ID: WP_006995246.1
Location: 494981..496012 (1032 bp)
Type: Toxin
Protein ID: WP_006995245.1
Type: Toxin
Protein ID: WP_006995245.1
Location: 491385..491552 (168 bp)
Type: Others
Protein ID: WP_006995248.1
Type: Others
Protein ID: WP_006995248.1
Location: 491819..492253 (435 bp)
Type: Others
Protein ID: WP_006995247.1
Type: Others
Protein ID: WP_006995247.1
Location: 492250..492690 (441 bp)
Type: Others
Protein ID: WP_005667635.1
Type: Others
Protein ID: WP_005667635.1
Location: 492787..493005 (219 bp)
Type: Others
Protein ID: WP_005650820.1
Type: Others
Protein ID: WP_005650820.1
Location: 496096..497754 (1659 bp)
Type: Others
Protein ID: WP_006995244.1
Type: Others
Protein ID: WP_006995244.1
Location: 497747..499492 (1746 bp)
Type: Others
Protein ID: WP_006995243.1
Type: Others
Protein ID: WP_006995243.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL190_RS02610 | 489887..490165 | + | 279 | WP_006995251.1 | cell division protein FtsB | - |
| EL190_RS02615 | 490165..490842 | + | 678 | WP_006995250.1 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | - |
| EL190_RS02620 | 490839..491315 | + | 477 | WP_006995249.1 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | - |
| EL190_RS10180 | 491385..491552 | - | 168 | WP_006995248.1 | hypothetical protein | - |
| EL190_RS02625 | 491819..492253 | - | 435 | WP_006995247.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EL190_RS02630 | 492250..492690 | - | 441 | WP_005667635.1 | FMN-binding protein MioC | - |
| EL190_RS02635 | 492787..493005 | - | 219 | WP_005650820.1 | cell division protein ZapB | - |
| EL190_RS02640 | 493167..494168 | + | 1002 | WP_005672749.1 | class II fructose-bisphosphatase | - |
| EL190_RS02645 | 494368..494676 | + | 309 | WP_005661200.1 | helix-turn-helix domain-containing protein | - |
| EL190_RS02650 | 494664..494984 | + | 321 | WP_006995246.1 | type II toxin-antitoxin system HipA family toxin | Antitoxin |
| EL190_RS02655 | 494981..496012 | + | 1032 | WP_006995245.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
| EL190_RS02660 | 496096..497754 | - | 1659 | WP_006995244.1 | thiol reductant ABC exporter subunit CydC | - |
| EL190_RS02665 | 497747..499492 | - | 1746 | WP_006995243.1 | ABC transporter ATP-binding protein/permease | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 344 a.a. Molecular weight: 39718.31 Da Isoelectric Point: 6.5777
>T287852 WP_006995245.1 NZ_LR134395:494981-496012 [Haemophilus aegyptius]
MNFCRILLKPLKKNEALSGYSAEGLHYLTGNKHFNPELPFSRQEFITVKPQKQQGMSISGFQPKLQLIIKDGHFDSVNQQ
GNYILKPSPEEYPFLAENEHATMRIMKELGFDVPENGLVSFAGEQNHKEFAFVIKRFDRDEQQKPMHQEQLDGAMNIRDK
YGKIGADNEQYVSYEQIAKFILQHTENHLAQQREIFRRIIYAYLLGNNDLHLRNFSFIYPKNSHPKLAPIYDFVSVSPYP
EIFNSTLLALPLLAREEGNATLAKGFNTQYGEYIGDDFVEFGENIGLNKNVIIQKLIPEITQEKEKVEQIYSQSFMPQPH
IDCVLKTYRKRLALLNLLNEPEL
MNFCRILLKPLKKNEALSGYSAEGLHYLTGNKHFNPELPFSRQEFITVKPQKQQGMSISGFQPKLQLIIKDGHFDSVNQQ
GNYILKPSPEEYPFLAENEHATMRIMKELGFDVPENGLVSFAGEQNHKEFAFVIKRFDRDEQQKPMHQEQLDGAMNIRDK
YGKIGADNEQYVSYEQIAKFILQHTENHLAQQREIFRRIIYAYLLGNNDLHLRNFSFIYPKNSHPKLAPIYDFVSVSPYP
EIFNSTLLALPLLAREEGNATLAKGFNTQYGEYIGDDFVEFGENIGLNKNVIIQKLIPEITQEKEKVEQIYSQSFMPQPH
IDCVLKTYRKRLALLNLLNEPEL
Download Length: 1032 bp