Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1785461..1786063 | Replicon | chromosome |
Accession | NZ_LR134365 | ||
Organism | Cardiobacterium hominis strain NCTC10426 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL199_RS08700 | Protein ID | WP_081447840.1 |
Coordinates | 1785461..1785739 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL199_RS08705 | Protein ID | WP_004142238.1 |
Coordinates | 1785749..1786063 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL199_RS08680 | 1780902..1781552 | - | 651 | WP_004142250.1 | ABC transporter ATP-binding protein | - |
EL199_RS08685 | 1781557..1782687 | - | 1131 | WP_004142249.1 | ABC transporter permease | - |
EL199_RS08690 | 1782677..1783957 | - | 1281 | WP_004142247.1 | ABC transporter permease | - |
EL199_RS08695 | 1783962..1785353 | - | 1392 | WP_004142244.1 | DUF2318 domain-containing protein | - |
EL199_RS08700 | 1785461..1785739 | + | 279 | WP_081447840.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL199_RS08705 | 1785749..1786063 | + | 315 | WP_004142238.1 | HigA family addiction module antidote protein | Antitoxin |
EL199_RS08710 | 1786115..1786864 | - | 750 | WP_004142236.1 | SDR family NAD(P)-dependent oxidoreductase | - |
EL199_RS08715 | 1786861..1787805 | - | 945 | WP_126316058.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
EL199_RS08720 | 1787844..1788116 | - | 273 | WP_004142231.1 | type II toxin-antitoxin system YafQ family toxin | - |
EL199_RS08725 | 1788109..1788408 | - | 300 | WP_004142230.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
EL199_RS08730 | 1788567..1789862 | + | 1296 | WP_004142227.1 | NCS2 family permease | - |
EL199_RS08735 | 1789875..1790030 | - | 156 | WP_197719326.1 | ribosome alternative rescue factor ArfA | - |
EL199_RS08740 | 1790226..1790804 | + | 579 | WP_040355599.1 | electron transport complex subunit RsxA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10747.22 Da Isoelectric Point: 8.3076
>T287818 WP_081447840.1 NZ_LR134365:1785461-1785739 [Cardiobacterium hominis]
MISNFSCKDTEALFRGRQVRRFIAIERIALRKLQQLHAASNLQFLRVPPGNRLEALQGNRAGQYSIHINDQWHICFCWED
GNANHVEIVDYH
MISNFSCKDTEALFRGRQVRRFIAIERIALRKLQQLHAASNLQFLRVPPGNRLEALQGNRAGQYSIHINDQWHICFCWED
GNANHVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|