287798

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/DinJ(antitoxin)
Location 1687160..1687793 Replicon chromosome
Accession NZ_LR134354
Organism Bifidobacterium longum subsp. infantis strain NCTC11817

Toxin (Protein)


Gene name mazF Uniprot ID W6EYF0
Locus tag EL189_RS08390 Protein ID WP_012577854.1
Coordinates 1687160..1687528 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID B7GS37
Locus tag EL189_RS08395 Protein ID WP_012577855.1
Coordinates 1687509..1687793 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL189_RS08345 1682790..1683047 + 258 WP_012577847.1 hypothetical protein -
EL189_RS08350 1683044..1683535 + 492 WP_012577848.1 hypothetical protein -
EL189_RS08355 1683681..1684085 - 405 WP_014484963.1 tyrosine-type recombinase/integrase -
EL189_RS08360 1684082..1684342 - 261 WP_012577849.1 hypothetical protein -
EL189_RS08365 1684497..1684841 - 345 WP_012577850.1 hypothetical protein -
EL189_RS08370 1684972..1685343 - 372 WP_012577851.1 hypothetical protein -
EL189_RS08375 1685450..1686205 - 756 WP_012577852.1 hypothetical protein -
EL189_RS08380 1686202..1686429 - 228 WP_014484964.1 hypothetical protein -
EL189_RS08385 1686426..1686971 - 546 WP_012577853.1 hypothetical protein -
EL189_RS08390 1687160..1687528 - 369 WP_012577854.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL189_RS08395 1687509..1687793 - 285 WP_012577855.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
EL189_RS08400 1687869..1688168 - 300 WP_012577856.1 hypothetical protein -
EL189_RS08405 1688256..1688438 - 183 WP_014484966.1 hypothetical protein -
EL189_RS08410 1688438..1688779 - 342 WP_012577857.1 hypothetical protein -
EL189_RS08415 1688781..1689566 - 786 WP_012577858.1 hypothetical protein -
EL189_RS08420 1689765..1690106 - 342 WP_012577859.1 hypothetical protein -
EL189_RS08425 1690220..1690564 - 345 WP_014484967.1 hypothetical protein -
EL189_RS13800 1690561..1690722 - 162 WP_155245937.1 hypothetical protein -
EL189_RS08430 1690812..1691426 - 615 WP_012577862.1 lysozyme -
EL189_RS08435 1691639..1691866 - 228 WP_025221588.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1660722..1723283 62561


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(16-111)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-53)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13866.75 Da        Isoelectric Point: 4.5746

>T287798 WP_012577854.1 NZ_LR134354:c1687528-1687160 [Bifidobacterium longum subsp. infantis]
MTSTPSEPRLYDVWLMWVEFPDHPGIGKPRPVVITEVDGDLVSGIVAKITGNTDWDEAGDVPLLDWKAEGLLKPSLVRCS
QRFYFNRSELLQWFGRLSLRDAEHVNDGLEATLDIPPYRRSV

Download         Length: 369 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10472.80 Da        Isoelectric Point: 5.0057

>AT287798 WP_012577855.1 NZ_LR134354:c1687793-1687509 [Bifidobacterium longum subsp. infantis]
MGKLVANIDDDVKARAAALYDSMGMSLSTAVNMFLRQSLVDNGLPFKPTRHTPDGYPVPPVHNAYMFERSEKGHVILPAD
WNDSEDAVYDQYAK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W6EYF0

Antitoxin

Source ID Structure
AlphaFold DB B7GS37

References