Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2038164..2038752 | Replicon | chromosome |
Accession | NZ_LR134352 | ||
Organism | Nocardia asteroides strain NCTC11293 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | EL493_RS09425 | Protein ID | WP_030200292.1 |
Coordinates | 2038164..2038445 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL493_RS09430 | Protein ID | WP_019045366.1 |
Coordinates | 2038459..2038752 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL493_RS09405 | 2034062..2035384 | - | 1323 | WP_019045361.1 | 2-oxo acid dehydrogenase subunit E2 | - |
EL493_RS09410 | 2035400..2036374 | - | 975 | WP_019045362.1 | alpha-ketoacid dehydrogenase subunit beta | - |
EL493_RS09415 | 2036371..2037453 | - | 1083 | WP_019045363.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
EL493_RS09420 | 2037624..2038115 | + | 492 | WP_019045364.1 | Lrp/AsnC family transcriptional regulator | - |
EL493_RS09425 | 2038164..2038445 | + | 282 | WP_030200292.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL493_RS09430 | 2038459..2038752 | + | 294 | WP_019045366.1 | HigA family addiction module antidote protein | Antitoxin |
EL493_RS09435 | 2038894..2040513 | + | 1620 | WP_019045367.1 | restriction endonuclease | - |
EL493_RS09440 | 2040645..2040830 | - | 186 | WP_030200277.1 | hypothetical protein | - |
EL493_RS09445 | 2040841..2041176 | + | 336 | WP_126405637.1 | hypothetical protein | - |
EL493_RS09450 | 2041180..2042376 | - | 1197 | WP_019045370.1 | benzoate/H(+) symporter BenE family transporter | - |
EL493_RS09455 | 2042604..2043410 | + | 807 | WP_197724382.1 | sulfurtransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.43 Da Isoelectric Point: 10.2158
>T287794 WP_030200292.1 NZ_LR134352:2038164-2038445 [Nocardia asteroides]
VIRSFGDRDTERLWHREHVKTFDSRILRVALRKLAILDAAVSLGELRVPPGNRLEALKGNRKGQYSLRINEQWRICFVWT
DAGPEQVAIVDYH
VIRSFGDRDTERLWHREHVKTFDSRILRVALRKLAILDAAVSLGELRVPPGNRLEALKGNRKGQYSLRINEQWRICFVWT
DAGPEQVAIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|