Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 220095..220792 | Replicon | chromosome |
| Accession | NZ_LR134352 | ||
| Organism | Nocardia asteroides strain NCTC11293 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | EL493_RS01135 | Protein ID | WP_036835380.1 |
| Coordinates | 220095..220463 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL493_RS01140 | Protein ID | WP_019049601.1 |
| Coordinates | 220460..220792 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL493_RS01115 | 215346..216029 | - | 684 | WP_019049596.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| EL493_RS01120 | 216080..217660 | - | 1581 | WP_019049597.1 | succinate-semialdehyde dehydrogenase (NADP(+)) | - |
| EL493_RS01125 | 217657..218586 | - | 930 | WP_019049598.1 | acetoacetate decarboxylase family protein | - |
| EL493_RS01130 | 218762..220015 | + | 1254 | WP_022566143.1 | NADH:flavin oxidoreductase/NADH oxidase family protein | - |
| EL493_RS01135 | 220095..220463 | + | 369 | WP_036835380.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL493_RS01140 | 220460..220792 | + | 333 | WP_019049601.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL493_RS01145 | 220850..221692 | - | 843 | WP_019049602.1 | hypothetical protein | - |
| EL493_RS01150 | 221686..222396 | - | 711 | WP_019049603.1 | HAD-IB family hydrolase | - |
| EL493_RS01155 | 222393..223169 | - | 777 | WP_022566141.1 | hypothetical protein | - |
| EL493_RS01160 | 223445..223897 | + | 453 | WP_019049605.1 | SRPBCC family protein | - |
| EL493_RS01165 | 223958..224398 | - | 441 | WP_036835092.1 | MarR family transcriptional regulator | - |
| EL493_RS01170 | 224522..225484 | + | 963 | WP_019049607.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13678.48 Da Isoelectric Point: 4.9473
>T287791 WP_036835380.1 NZ_LR134352:220095-220463 [Nocardia asteroides]
VTWEIVLHPEVESWFLAICGTDPETGDLIERAIDHLASEGPSLGRPLVDRIKGSRYHNMKELRPASTGTTEVRILFAFDP
ARAAAMLVAGDKSNFWQGWYSEAIPLADKRFTEHLEALKEQS
VTWEIVLHPEVESWFLAICGTDPETGDLIERAIDHLASEGPSLGRPLVDRIKGSRYHNMKELRPASTGTTEVRILFAFDP
ARAAAMLVAGDKSNFWQGWYSEAIPLADKRFTEHLEALKEQS
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|