287790

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2948221..2948644 Replicon chromosome
Accession NZ_LR134351
Organism Staphylococcus aureus strain NCTC13811

Toxin (Protein)


Gene name higB Uniprot ID A0A6B5KJM6
Locus tag EL160_RS15380 Protein ID WP_001065110.1
Coordinates 2948221..2948472 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E1X568
Locus tag EL160_RS15385 Protein ID WP_000028425.1
Coordinates 2948462..2948644 (+) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL160_RS15345 2944313..2944870 + 558 WP_000645048.1 DUF2815 family protein -
EL160_RS15350 2944938..2946890 + 1953 WP_001802096.1 DNA polymerase -
EL160_RS15355 2946903..2947088 + 186 WP_001164629.1 DUF3113 family protein -
EL160_RS15360 2947088..2947489 + 402 WP_000113974.1 PVL family protein -
EL160_RS15365 2947489..2947746 + 258 WP_000022730.1 DUF3310 domain-containing protein -
EL160_RS15370 2947749..2947949 + 201 WP_000235324.1 hypothetical protein -
EL160_RS15375 2947964..2948206 + 243 WP_000132193.1 hypothetical protein -
EL160_RS15380 2948221..2948472 + 252 WP_001065110.1 DUF1024 family protein Toxin
EL160_RS15385 2948462..2948644 + 183 WP_000028425.1 hypothetical protein Antitoxin
EL160_RS15390 2948637..2949173 + 537 WP_000185703.1 dUTPase -
EL160_RS15395 2949210..2949446 + 237 WP_000195806.1 DUF1381 domain-containing protein -
EL160_RS15400 2949471..2949707 + 237 WP_000483477.1 hypothetical protein -
EL160_RS15405 2949700..2949852 + 153 WP_000595237.1 transcriptional activator RinB -
EL160_RS15410 2949920..2950120 + 201 WP_000265258.1 DUF1514 family protein -
EL160_RS15415 2950173..2952620 + 2448 WP_129545263.1 virulence-associated E family protein -
EL160_RS15420 2952723..2952827 - 105 WP_015978074.1 hypothetical protein -
EL160_RS15600 2952961..2953249 + 289 Protein_2884 VRR-NUC domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9405.32 Da        Isoelectric Point: 3.8051

>T287790 WP_001065110.1 NZ_LR134351:2948221-2948472 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6781.65 Da        Isoelectric Point: 4.4421

>AT287790 WP_000028425.1 NZ_LR134351:2948462-2948644 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDGSIISLIDFVIKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6B5KJM6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E1X568

References