Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2320832..2321016 | Replicon | chromosome |
| Accession | NZ_LR134351 | ||
| Organism | Staphylococcus aureus strain NCTC13811 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | EL160_RS12420 | Protein ID | WP_000482647.1 |
| Coordinates | 2320909..2321016 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2320832..2320892 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL160_RS12395 | 2316342..2316509 | - | 168 | Protein_2304 | hypothetical protein | - |
| EL160_RS12405 | 2316740..2318473 | - | 1734 | WP_129545282.1 | ABC transporter ATP-binding protein/permease | - |
| EL160_RS12410 | 2318498..2320261 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2320832..2320892 | + | 61 | - | - | Antitoxin |
| EL160_RS12420 | 2320909..2321016 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| EL160_RS12425 | 2321150..2321536 | - | 387 | WP_000779351.1 | flippase GtxA | - |
| EL160_RS12430 | 2321804..2322946 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
| EL160_RS12435 | 2323006..2323665 | + | 660 | WP_000831298.1 | membrane protein | - |
| EL160_RS12440 | 2323847..2325058 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
| EL160_RS12445 | 2325181..2325654 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T287789 WP_000482647.1 NZ_LR134351:c2321016-2320909 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT287789 NZ_LR134351:2320832-2320892 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|