Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2032342..2032558 | Replicon | chromosome |
Accession | NZ_LR134351 | ||
Organism | Staphylococcus aureus strain NCTC13811 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | EL160_RS10850 | Protein ID | WP_073392962.1 |
Coordinates | 2032454..2032558 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2032342..2032397 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL160_RS10830 | 2027435..2027755 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
EL160_RS10835 | 2027757..2028737 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
EL160_RS10840 | 2029003..2030094 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
EL160_RS10845 | 2030382..2032028 | + | 1647 | WP_042363653.1 | IS1182-like element ISSau3 family transposase | - |
- | 2032342..2032397 | + | 56 | - | - | Antitoxin |
EL160_RS10850 | 2032454..2032558 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
EL160_RS10860 | 2033238..2033396 | + | 159 | WP_001792784.1 | hypothetical protein | - |
EL160_RS10870 | 2034055..2034912 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
EL160_RS10875 | 2034980..2035762 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2030382..2032028 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T287786 WP_073392962.1 NZ_LR134351:c2032558-2032454 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT287786 NZ_LR134351:2032342-2032397 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|