Detailed information of TA system TA287781

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): txpA-SprF2/-
• Location: 1842087..1842386
• Replicon: chromosome
• Accession: NZ_LR134351
• Organism: Staphylococcus aureus strain NCTC13811

Toxin (Protein)

• Gene name: txpA
• Uniprot ID: -
• Locus tag: EL160_RS09705
• Protein ID: WP_078103063.1
• Coordinates: 1842210..1842386 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	SprF2
Locus tag	-
Coordinates	1842087..1842142 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EL160_RS09645	1837117..1837367	+	251	Protein_1791	sphingomyelin phosphodiesterase	-
EL160_RS09650	1837689..1837868	+	180	WP_000669789.1	hypothetical protein	-
EL160_RS09660	1838179..1838439	+	261	WP_001791826.1	hypothetical protein	-
EL160_RS09665	1838492..1838842	-	351	WP_000702262.1	complement inhibitor SCIN-A	-
EL160_RS09670	1839353..1839691	-	339	Protein_1795	SH3 domain-containing protein	-
EL160_RS09685	1840295..1840786	-	492	WP_000920041.1	staphylokinase	-
EL160_RS09690	1840977..1841732	-	756	WP_000861038.1	CHAP domain-containing protein	-
EL160_RS09695	1841744..1841998	-	255	WP_000611512.1	phage holin	-
EL160_RS09700	1842050..1842157	+	108	WP_001791821.1	hypothetical protein	-
-	1842079..1842218	+	140	NuclAT_1	-	-
-	1842079..1842218	+	140	NuclAT_1	-	-
-	1842079..1842218	+	140	NuclAT_1	-	-
-	1842079..1842218	+	140	NuclAT_1	-	-
-	1842087..1842142	+	56	-	-	Antitoxin
EL160_RS09705	1842210..1842386	-	177	WP_078103063.1	putative holin-like toxin	Toxin
EL160_RS09710	1842495..1843268	-	774	WP_000750407.1	staphylococcal enterotoxin type A	-
EL160_RS09715	1843689..1844063	-	375	WP_042363643.1	hypothetical protein	-
EL160_RS09720	1844119..1844406	-	288	WP_064137108.1	hypothetical protein	-
EL160_RS09725	1844453..1844605	-	153	WP_001153681.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	scn / sak / sea / hlb / tsst-1 / groEL	1838492..1905311	66819

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (30-58)

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6873.43 Da
• Isoelectric Point: 10.6777

>T287781 WP_078103063.1 NZ_LR134351:c1842386-1842210 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALHKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Nucleotide

• Length: 177 bp

Antitoxin

Nucleotide

• Length: 56 bp

>AT287781 NZ_LR134351:1842087-1842142 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Structures

Antitoxin