287779

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1756413..1756836 Replicon chromosome
Accession NZ_LR134351
Organism Staphylococcus aureus strain NCTC13811

Toxin (Protein)


Gene name higB Uniprot ID A0A5S9I4Y6
Locus tag EL160_RS09170 Protein ID WP_001065091.1
Coordinates 1756585..1756836 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E0VQM8
Locus tag EL160_RS09165 Protein ID WP_000028422.1
Coordinates 1756413..1756595 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL160_RS09115 1752103..1753392 - 1290 WP_046377028.1 PBSX family phage terminase large subunit -
EL160_RS09120 1753395..1753889 - 495 WP_043856039.1 terminase small subunit -
EL160_RS09125 1754076..1754495 - 420 WP_000058632.1 transcriptional regulator -
EL160_RS09130 1754510..1754656 - 147 WP_064140784.1 hypothetical protein -
EL160_RS09135 1754657..1754830 - 174 WP_000595271.1 transcriptional activator RinB -
EL160_RS09140 1754827..1755216 - 390 WP_192795223.1 hypothetical protein -
EL160_RS09145 1755206..1755442 - 237 WP_000608278.1 hypothetical protein -
EL160_RS09150 1755435..1755638 - 204 WP_001072794.1 hypothetical protein -
EL160_RS09155 1755635..1755841 - 207 WP_000195812.1 DUF1381 domain-containing protein -
EL160_RS09160 1755878..1756420 - 543 WP_000185659.1 dUTP pyrophosphatase -
EL160_RS09165 1756413..1756595 - 183 WP_000028422.1 hypothetical protein Antitoxin
EL160_RS09170 1756585..1756836 - 252 WP_001065091.1 DUF1024 family protein Toxin
EL160_RS15495 1756829..1756993 - 165 WP_000990744.1 hypothetical protein -
EL160_RS09175 1757008..1757250 - 243 WP_000131366.1 hypothetical protein -
EL160_RS09180 1757254..1757622 - 369 WP_000101274.1 hypothetical protein -
EL160_RS09185 1757635..1757944 - 310 Protein_1701 RusA family crossover junction endodeoxyribonuclease -
EL160_RS09190 1757953..1758171 - 219 WP_000338531.1 hypothetical protein -
EL160_RS09195 1758178..1759062 - 885 WP_000148316.1 DnaD domain protein -
EL160_RS09200 1759092..1759562 - 471 WP_000934764.1 single-stranded DNA-binding protein -
EL160_RS09205 1759563..1760180 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
EL160_RS09210 1760261..1761181 - 921 WP_000138472.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1726243..1772956 46713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9349.22 Da        Isoelectric Point: 3.9473

>T287779 WP_001065091.1 NZ_LR134351:c1756836-1756585 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEH

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6741.63 Da        Isoelectric Point: 4.2658

>AT287779 WP_000028422.1 NZ_LR134351:c1756595-1756413 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEEQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5S9I4Y6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VQM8

References