Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1641702..1641882 | Replicon | chromosome |
Accession | NZ_LR134351 | ||
Organism | Staphylococcus aureus strain NCTC13811 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EL160_RS08365 | Protein ID | WP_001801861.1 |
Coordinates | 1641702..1641797 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1641825..1641882 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL160_RS08330 | 1636846..1637472 | + | 627 | WP_000669038.1 | hypothetical protein | - |
EL160_RS08335 | 1637513..1637857 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
EL160_RS08340 | 1637955..1638527 | + | 573 | WP_000414222.1 | hypothetical protein | - |
EL160_RS08345 | 1638676..1640043 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
EL160_RS08350 | 1640043..1640612 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
EL160_RS08355 | 1640805..1641251 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
EL160_RS08365 | 1641702..1641797 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1641825..1641882 | - | 58 | - | - | Antitoxin |
EL160_RS08370 | 1641920..1642021 | + | 102 | WP_001791232.1 | hypothetical protein | - |
EL160_RS08375 | 1642196..1642639 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
EL160_RS08380 | 1642639..1643082 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
EL160_RS08385 | 1643082..1643524 | - | 443 | Protein_1583 | DUF1433 domain-containing protein | - |
EL160_RS08390 | 1644049..1646468 | + | 2420 | Protein_1584 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T287777 WP_001801861.1 NZ_LR134351:1641702-1641797 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT287777 NZ_LR134351:c1641882-1641825 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|