Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1293948..1294371 Replicon chromosome
Accession NZ_LR134351
Organism Staphylococcus aureus strain NCTC13811

Toxin (Protein)


Gene name higB Uniprot ID A0A6B5KJM6
Locus tag EL160_RS06535 Protein ID WP_001065110.1
Coordinates 1294120..1294371 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E1X568
Locus tag EL160_RS06530 Protein ID WP_000028425.1
Coordinates 1293948..1294130 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL160_RS06490 1289341..1289631 - 291 WP_000665205.1 VRR-NUC domain-containing protein -
EL160_RS06495 1289765..1289869 + 105 WP_015978074.1 hypothetical protein -
EL160_RS06500 1289972..1292419 - 2448 WP_129545263.1 virulence-associated E family protein -
EL160_RS06505 1292472..1292672 - 201 WP_000265258.1 DUF1514 family protein -
EL160_RS06510 1292740..1292892 - 153 WP_000595237.1 transcriptional activator RinB -
EL160_RS06515 1292885..1293121 - 237 WP_000483477.1 hypothetical protein -
EL160_RS06520 1293146..1293382 - 237 WP_000195806.1 DUF1381 domain-containing protein -
EL160_RS06525 1293419..1293955 - 537 WP_000185703.1 dUTPase -
EL160_RS06530 1293948..1294130 - 183 WP_000028425.1 hypothetical protein Antitoxin
EL160_RS06535 1294120..1294371 - 252 WP_001065110.1 DUF1024 family protein Toxin
EL160_RS06540 1294386..1294628 - 243 WP_000132193.1 hypothetical protein -
EL160_RS06545 1294643..1294843 - 201 WP_000235324.1 hypothetical protein -
EL160_RS06550 1294846..1295103 - 258 WP_000022730.1 DUF3310 domain-containing protein -
EL160_RS06555 1295103..1295504 - 402 WP_000113974.1 PVL family protein -
EL160_RS06560 1295504..1295689 - 186 WP_001164629.1 DUF3113 family protein -
EL160_RS06565 1295702..1297654 - 1953 WP_001802096.1 DNA polymerase -
EL160_RS06570 1297722..1298279 - 558 WP_000645048.1 DUF2815 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1261897..1324289 62392


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9405.32 Da        Isoelectric Point: 3.8051

>T287774 WP_001065110.1 NZ_LR134351:c1294371-1294120 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKARAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6781.65 Da        Isoelectric Point: 4.4421

>AT287774 WP_000028425.1 NZ_LR134351:c1294130-1293948 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDGSIISLIDFVIKPIHLIKEAQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6B5KJM6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E1X568

References