Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-sprA1AS/- |
Location | 1264809..1265108 | Replicon | chromosome |
Accession | NZ_LR134351 | ||
Organism | Staphylococcus aureus strain NCTC13811 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EL160_RS06360 | Protein ID | WP_011447039.1 |
Coordinates | 1264932..1265108 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1264809..1264864 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL160_RS06320 | 1259936..1260844 | - | 909 | WP_000476878.1 | DUF1672 domain-containing protein | - |
EL160_RS06325 | 1260902..1261807 | - | 906 | WP_000913238.1 | DUF1672 domain-containing protein | - |
EL160_RS06330 | 1261897..1262112 | - | 216 | WP_000209712.1 | hypothetical protein | - |
EL160_RS06335 | 1262485..1263321 | - | 837 | WP_000675478.1 | hypothetical protein | - |
EL160_RS06345 | 1263699..1264454 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EL160_RS06350 | 1264466..1264720 | - | 255 | WP_000611512.1 | phage holin | - |
EL160_RS06355 | 1264772..1264879 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1264801..1264940 | + | 140 | NuclAT_0 | - | - |
- | 1264801..1264940 | + | 140 | NuclAT_0 | - | - |
- | 1264801..1264940 | + | 140 | NuclAT_0 | - | - |
- | 1264801..1264940 | + | 140 | NuclAT_0 | - | - |
- | 1264809..1264864 | + | 56 | - | - | Antitoxin |
EL160_RS06360 | 1264932..1265108 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EL160_RS06365 | 1265261..1265560 | - | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
EL160_RS06370 | 1265606..1265770 | - | 165 | WP_000916020.1 | XkdX family protein | - |
EL160_RS06375 | 1265763..1266152 | - | 390 | WP_001166599.1 | DUF2977 domain-containing protein | - |
EL160_RS06380 | 1266152..1267618 | - | 1467 | WP_000067155.1 | BppU family phage baseplate upper protein | - |
EL160_RS06385 | 1267618..1269528 | - | 1911 | WP_000429551.1 | minor structural protein | - |
EL160_RS06390 | 1269544..1269834 | - | 291 | WP_000179860.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1261897..1324289 | 62392 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T287773 WP_011447039.1 NZ_LR134351:c1265108-1264932 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT287773 NZ_LR134351:1264809-1264864 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|