Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 11423..11761 | Replicon | chromosome |
| Accession | NZ_LR134351 | ||
| Organism | Staphylococcus aureus strain NCTC13811 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | EL160_RS00050 | Protein ID | WP_011447039.1 |
| Coordinates | 11423..11599 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 11587..11761 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL160_RS00020 | 6697..6987 | + | 291 | WP_000179860.1 | hypothetical protein | - |
| EL160_RS00025 | 7003..8913 | + | 1911 | WP_000429551.1 | minor structural protein | - |
| EL160_RS00030 | 8913..10379 | + | 1467 | WP_000067155.1 | BppU family phage baseplate upper protein | - |
| EL160_RS00035 | 10379..10768 | + | 390 | WP_001166599.1 | DUF2977 domain-containing protein | - |
| EL160_RS00040 | 10761..10925 | + | 165 | WP_000916020.1 | XkdX family protein | - |
| EL160_RS00045 | 10971..11270 | + | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
| EL160_RS00050 | 11423..11599 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| - | 11587..11761 | - | 175 | - | - | Antitoxin |
| EL160_RS00060 | 11811..12065 | + | 255 | WP_000611512.1 | phage holin | - |
| EL160_RS00065 | 12077..12832 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| EL160_RS00075 | 13685..14512 | - | 828 | WP_000136022.1 | alpha/beta hydrolase | - |
| EL160_RS00080 | 14570..15784 | - | 1215 | WP_000286469.1 | NADH-dependent flavin oxidoreductase | - |
| EL160_RS00085 | 15880..15978 | + | 99 | WP_001803958.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 319..17093 | 16774 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T287768 WP_011447039.1 NZ_LR134351:11423-11599 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT287768 NZ_LR134351:c11761-11587 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|