Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 1944962..1945557 | Replicon | chromosome |
| Accession | NZ_LR134342 | ||
| Organism | Pseudomonas aeruginosa strain NCTC10728 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | EL327_RS09495 | Protein ID | WP_003113526.1 |
| Coordinates | 1945279..1945557 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL327_RS09490 | Protein ID | WP_003113527.1 |
| Coordinates | 1944962..1945267 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL327_RS09460 | 1940490..1940780 | - | 291 | WP_126438354.1 | DUF5447 family protein | - |
| EL327_RS09465 | 1940784..1940999 | - | 216 | WP_042911940.1 | hypothetical protein | - |
| EL327_RS09470 | 1940992..1941264 | - | 273 | WP_025324668.1 | hypothetical protein | - |
| EL327_RS09480 | 1941715..1942047 | + | 333 | WP_079282649.1 | hypothetical protein | - |
| EL327_RS09485 | 1942182..1944653 | + | 2472 | WP_126438355.1 | SIR2 family protein | - |
| EL327_RS09490 | 1944962..1945267 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
| EL327_RS09495 | 1945279..1945557 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL327_RS09505 | 1945886..1948114 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| EL327_RS09510 | 1948184..1948831 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| EL327_RS09515 | 1948893..1950131 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T287762 WP_003113526.1 NZ_LR134342:c1945557-1945279 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|