Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1320368..1321049 | Replicon | chromosome |
Accession | NZ_LR134342 | ||
Organism | Pseudomonas aeruginosa strain NCTC10728 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | EL327_RS06580 | Protein ID | WP_015503432.1 |
Coordinates | 1320684..1321049 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL327_RS06575 | Protein ID | WP_016561576.1 |
Coordinates | 1320368..1320691 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL327_RS06535 | 1316261..1316944 | - | 684 | WP_003120766.1 | TetR/AcrR family transcriptional regulator | - |
EL327_RS06540 | 1317032..1317910 | + | 879 | WP_003163191.1 | hypothetical protein | - |
EL327_RS06550 | 1318513..1318740 | + | 228 | WP_014603215.1 | hypothetical protein | - |
EL327_RS06555 | 1318755..1319297 | - | 543 | WP_019396018.1 | tyrosine-type recombinase/integrase | - |
EL327_RS06560 | 1319472..1319747 | - | 276 | WP_004353146.1 | hypothetical protein | - |
EL327_RS06565 | 1319747..1320078 | - | 332 | Protein_1269 | hypothetical protein | - |
EL327_RS06570 | 1320133..1320252 | + | 120 | Protein_1270 | IS5/IS1182 family transposase | - |
EL327_RS06575 | 1320368..1320691 | - | 324 | WP_016561576.1 | XRE family transcriptional regulator | Antitoxin |
EL327_RS06580 | 1320684..1321049 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL327_RS06585 | 1321313..1321555 | - | 243 | WP_043884955.1 | hypothetical protein | - |
EL327_RS06590 | 1321762..1322034 | + | 273 | WP_003085667.1 | hypothetical protein | - |
EL327_RS06595 | 1322053..1322478 | - | 426 | WP_034024285.1 | VOC family protein | - |
EL327_RS06600 | 1322579..1323463 | + | 885 | WP_003454589.1 | LysR family transcriptional regulator | - |
EL327_RS06605 | 1323436..1324389 | - | 954 | WP_003085661.1 | LysR family transcriptional regulator | - |
EL327_RS06610 | 1324610..1325044 | + | 435 | WP_016253806.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T287761 WP_015503432.1 NZ_LR134342:c1321049-1320684 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|