Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2332129..2332354 | Replicon | chromosome |
| Accession | NZ_LR134340 | ||
| Organism | Escherichia marmotae strain NCTC11133 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | EL192_RS11170 | Protein ID | WP_000813254.1 |
| Coordinates | 2332129..2332284 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2332296..2332354 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL192_RS11130 | 2327252..2327749 | - | 498 | WP_001135310.1 | lysozyme RrrD | - |
| EL192_RS11135 | 2327749..2327964 | - | 216 | WP_000839565.1 | phage lysis protein EssD | - |
| EL192_RS11140 | 2328216..2328590 | - | 375 | WP_001348108.1 | hypothetical protein | - |
| EL192_RS11145 | 2328762..2329190 | - | 429 | WP_000506936.1 | cell envelope integrity protein TolA | - |
| EL192_RS11150 | 2330235..2330777 | - | 543 | WP_000640161.1 | DUF1133 family protein | - |
| EL192_RS11155 | 2330774..2331064 | - | 291 | WP_000247763.1 | DUF1364 domain-containing protein | - |
| EL192_RS11160 | 2331064..2331663 | - | 600 | WP_000940319.1 | DUF1367 family protein | - |
| EL192_RS11170 | 2332129..2332284 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2332296..2332354 | + | 59 | - | - | Antitoxin |
| EL192_RS11185 | 2332861..2333769 | + | 909 | WP_001297700.1 | bacteriophage abortive infection AbiH family protein | - |
| EL192_RS11190 | 2333859..2335250 | + | 1392 | WP_000982358.1 | hypothetical protein | - |
| EL192_RS11195 | 2335513..2335935 | - | 423 | WP_016247241.1 | DUF977 family protein | - |
| EL192_RS11200 | 2335976..2337046 | - | 1071 | WP_001262357.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2298977..2346036 | 47059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T287754 WP_000813254.1 NZ_LR134340:c2332284-2332129 [Escherichia marmotae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT287754 NZ_LR134340:2332296-2332354 [Escherichia marmotae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|