Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1238693..1239282 | Replicon | chromosome |
Accession | NZ_LR134339 | ||
Organism | Corynebacterium minutissimum strain NCTC10285 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | EL179_RS05845 | Protein ID | WP_082013920.1 |
Coordinates | 1238693..1238974 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EL179_RS05850 | Protein ID | WP_039674786.1 |
Coordinates | 1238983..1239282 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL179_RS05825 | 1234213..1235187 | - | 975 | WP_039674779.1 | selenide, water dikinase SelD | - |
EL179_RS05835 | 1235339..1236625 | + | 1287 | WP_039674781.1 | L-seryl-tRNA(Sec) selenium transferase | - |
EL179_RS05840 | 1236626..1238392 | + | 1767 | WP_039674782.1 | selenocysteine-specific translation elongation factor | - |
EL179_RS05845 | 1238693..1238974 | + | 282 | WP_082013920.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL179_RS05850 | 1238983..1239282 | + | 300 | WP_039674786.1 | HigA family addiction module antidote protein | Antitoxin |
EL179_RS05855 | 1239292..1239546 | - | 255 | WP_039674787.1 | hypothetical protein | - |
EL179_RS05860 | 1239795..1240613 | - | 819 | WP_039674788.1 | hypothetical protein | - |
EL179_RS05865 | 1240739..1241536 | + | 798 | WP_039674792.1 | zinc transporter ZupT | - |
EL179_RS05870 | 1241540..1242460 | - | 921 | WP_039674794.1 | DUF808 domain-containing protein | - |
EL179_RS05875 | 1242505..1243041 | - | 537 | WP_039674795.1 | DUF402 domain-containing protein | - |
EL179_RS05880 | 1243041..1243763 | - | 723 | WP_039674796.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10797.29 Da Isoelectric Point: 10.8344
>T287744 WP_082013920.1 NZ_LR134339:1238693-1238974 [Corynebacterium minutissimum]
MIQSFANRDTELVWLRQASPRIDSRIHKTANRKLHQLDAAVSLQSLRVPPGNRLEALKGDRKGMYSIRVNQQWRITFRWT
EAGPADVAIEDYH
MIQSFANRDTELVWLRQASPRIDSRIHKTANRKLHQLDAAVSLQSLRVPPGNRLEALKGDRKGMYSIRVNQQWRITFRWT
EAGPADVAIEDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|