Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 395818..396330 | Replicon | chromosome |
Accession | NZ_LR134336 | ||
Organism | Streptococcus oralis ATCC 35037 strain NCTC 11427 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | D4FRF2 |
Locus tag | EL140_RS01985 | Protein ID | WP_000924723.1 |
Coordinates | 396076..396330 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | EL140_RS01980 | Protein ID | WP_004181012.1 |
Coordinates | 395818..396072 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL140_RS01945 | 391579..391890 | + | 312 | WP_000060169.1 | ribosome assembly RNA-binding protein YhbY | - |
EL140_RS01950 | 391941..392570 | + | 630 | WP_000963719.1 | nicotinate-nucleotide adenylyltransferase | - |
EL140_RS01955 | 392570..393163 | + | 594 | WP_000331233.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
EL140_RS01960 | 393164..393517 | + | 354 | WP_001003013.1 | ribosome silencing factor | - |
EL140_RS01970 | 393832..394578 | + | 747 | WP_078232917.1 | class I SAM-dependent methyltransferase | - |
EL140_RS01975 | 394588..395685 | + | 1098 | WP_000156374.1 | nucleotidyltransferase | - |
EL140_RS01980 | 395818..396072 | + | 255 | WP_004181012.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL140_RS01985 | 396076..396330 | + | 255 | WP_000924723.1 | Txe/YoeB family addiction module toxin | Toxin |
EL140_RS01990 | 396534..398147 | + | 1614 | WP_000404956.1 | ribonuclease Y | - |
EL140_RS01995 | 398282..398908 | + | 627 | WP_000775041.1 | guanylate kinase | - |
EL140_RS02000 | 398933..399247 | + | 315 | WP_002874282.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10113.58 Da Isoelectric Point: 7.9716
>T287739 WP_000924723.1 NZ_LR134336:396076-396330 [Streptococcus oralis ATCC 35037]
MLLKFTEDAWADYCYWQNQDKKTLKRINKLIKDIQRDPFVGMGKPEPLKYDYQGAWSRRIDAENRLIYMIDGDSVAFLSF
KDHY
MLLKFTEDAWADYCYWQNQDKKTLKRINKLIKDIQRDPFVGMGKPEPLKYDYQGAWSRRIDAENRLIYMIDGDSVAFLSF
KDHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|