Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 3035766..3036268 | Replicon | chromosome |
| Accession | NZ_LR134335 | ||
| Organism | Yersinia enterocolitica subsp. palearctica strain NCTC13769 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | A0A7T9Y4I7 |
| Locus tag | EL202_RS14435 | Protein ID | WP_005156563.1 |
| Coordinates | 3036014..3036268 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A7U7FIK7 |
| Locus tag | EL202_RS14430 | Protein ID | WP_005156566.1 |
| Coordinates | 3035766..3036017 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL202_RS14420 | 3031119..3032864 | + | 1746 | WP_005156574.1 | ABC transporter ATP-binding protein/permease | - |
| EL202_RS14425 | 3032849..3035635 | + | 2787 | WP_014609335.1 | insulinase family protein | - |
| EL202_RS14430 | 3035766..3036017 | + | 252 | WP_005156566.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| EL202_RS14435 | 3036014..3036268 | + | 255 | WP_005156563.1 | Txe/YoeB family addiction module toxin | Toxin |
| EL202_RS14440 | 3036292..3038628 | - | 2337 | WP_005156561.1 | mechanosensitive ion channel family protein | - |
| EL202_RS14445 | 3039047..3041179 | + | 2133 | WP_005156559.1 | TonB-dependent siderophore receptor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10097.60 Da Isoelectric Point: 9.4486
>T287734 WP_005156563.1 NZ_LR134335:3036014-3036268 [Yersinia enterocolitica subsp. palearctica]
VRIIFSSCSWEDYLYWQQTDKKILKRINELVKNIQRTPFEGKGKPEPLKHNLAGFWSRRITEEHRLVYEVSGDNLLIAAC
RYHY
VRIIFSSCSWEDYLYWQQTDKKILKRINELVKNIQRTPFEGKGKPEPLKHNLAGFWSRRITEEHRLVYEVSGDNLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T9Y4I7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7FIK7 |